Ecosyste.ms: Packages

An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.

nuget.org "AWS" keyword

Top 7.4% on nuget.org
awssdk.core 3.7.303
The Amazon Web Services SDK for .NET - Core Runtime
1,063 versions - Latest release: about 2 months ago - 792 million downloads total - 2,006 stars on GitHub - 1 maintainer
Top 7.4% on nuget.org
awssdk.s3 3.7.307
Amazon Simple Storage Service (Amazon S3), provides developers and IT teams with secure, durable,...
1,075 versions - Latest release: about 2 months ago - 245 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.sqs 3.7.301
Amazon Simple Queue Service (SQS) is a fast, reliable, scalable, fully managed message queuing se...
971 versions - Latest release: 4 days ago - 116 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.securitytoken 3.7.300
The AWS Security Token Service (AWS STS) enables you to provide trusted users with temporary cred...
978 versions - Latest release: 6 months ago - 114 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.extensions.netcore.setup 3.7.300
Extensions for the AWS SDK for .NET to integrate with .NET Core configuration and dependency inje...
23 versions - Latest release: 6 months ago - 102 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.dynamodbv2 3.7.303
Amazon DynamoDB is a fast and flexible NoSQL database service for all applications that need cons...
1,007 versions - Latest release: 10 days ago - 92.7 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.simplesystemsmanagement 3.7.304
Amazon EC2 Simple Systems Manager (SSM) enables you to manage a number of administrative and conf...
1,036 versions - Latest release: 18 days ago - 80.6 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.simplenotificationservice 3.7.301
Amazon Simple Notification Service (Amazon SNS) is a fast, flexible, fully managed push messaging...
953 versions - Latest release: 3 months ago - 80.1 million downloads total - 2,004 stars on GitHub - 1 maintainer
awssdk.secretsmanager 3.7.302
AWS Secrets Manager enables you to easily create and manage the secrets that you use in your cust...
922 versions - Latest release: 5 months ago - 72.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.lambda.core 2.2.0
Amazon Lambda .NET Core support - Core package.
6 versions - Latest release: 7 months ago - 69.3 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.cloudwatchlogs 3.7.305
Amazon CloudWatch is a monitoring service for AWS cloud resources and the applications you run on...
980 versions - Latest release: about 2 months ago - 46 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.lambda 3.7.305
AWS Lambda is a compute service that runs your code in response to events and automatically manag...
1,011 versions - Latest release: about 1 month ago - 44.9 million downloads total - 2,007 stars on GitHub - 1 maintainer
amazon.lambda.serialization.systemtextjson 2.4.3
Amazon Lambda .NET Core support - Serialization.Json with System.Text.Json.
12 versions - Latest release: 17 days ago - 36.5 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.simpleemail 3.7.300
Amazon SES is an outbound-only email-sending service that provides an easy, cost-effective way fo...
966 versions - Latest release: 6 months ago - 35.2 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.keymanagementservice 3.7.302
AWS Key Management Service (KMS) is a managed service that makes it easy for you to create and co...
972 versions - Latest release: 30 days ago - 32.4 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.lambda.apigatewayevents 2.7.0
Amazon Lambda .NET Core support - API Gateway package.
18 versions - Latest release: 7 months ago - 31.7 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.kinesis 3.7.301
Amazon Kinesis is a fully managed, cloud-based service for real-time processing of large, distrib...
965 versions - Latest release: 6 months ago - 26.5 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.cloudwatch 3.7.304
Amazon CloudWatch is a monitoring service for AWS cloud resources and the applications you run on...
972 versions - Latest release: about 1 month ago - 26.2 million downloads total - 2,005 stars on GitHub - 1 maintainer
amazon.lambda.serialization.json 2.2.1
Amazon Lambda .NET Core support - Serialization.Json package.
15 versions - Latest release: about 1 month ago - 25.5 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.cognitoidentityprovider 3.7.305
You can create a user pool in Amazon Cognito Identity to manage directories and users. You can au...
970 versions - Latest release: 4 days ago - 25.5 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.extensions.configuration.systemsmanager 6.1.1
.NET Configuration Extensions for AWS Systems Manager
20 versions - Latest release: 22 days ago - 25.2 million downloads total - 171 stars on GitHub - 1 maintainer
amazon.lambda.sqsevents 2.2.0
Amazon Lambda .NET Core support - SQSEvents package.
6 versions - Latest release: 7 months ago - 24.4 million downloads total - 1,530 stars on GitHub - 1 maintainer
amazon.lambda.logging.aspnetcore 3.1.0
Amazon Lambda .NET Core support - Logging ASP.NET Core package.
9 versions - Latest release: over 3 years ago - 20.9 million downloads total - 1 maintainer
awssdk.ec2 3.7.327
Amazon Elastic Compute Cloud (Amazon EC2) is a web service that provides resizable compute capaci...
1,194 versions - Latest release: 4 days ago - 19.9 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.identitymanagement 3.7.301
AWS Identity and Access Management (IAM) enables you to securely control access to AWS services a...
984 versions - Latest release: about 1 month ago - 19.4 million downloads total - 2,007 stars on GitHub - 1 maintainer
amazon.lambda.tools 5.10.5
Amazon.Lambda.Tools adds commands to the dotnet cli to deploy AWS Lambda functions.
78 versions - Latest release: 18 days ago - 19.3 million downloads total - 365 stars on GitHub - 1 maintainer
awssdk.cognitoidentity 3.7.300
Amazon Cognito is a service that makes it easy to save user data, such as app preferences or game...
964 versions - Latest release: 6 months ago - 19 million downloads total - 2,006 stars on GitHub - 1 maintainer
awsxrayrecorder.core 2.14.0
The AWS X-Ray Recorder core runtime.
29 versions - Latest release: about 1 year ago - 18.9 million downloads total - 1 maintainer
aws.logger.core 3.3.1
AWS Core logging library used to send logging messages to Amazon CloudWatch Logs
25 versions - Latest release: 20 days ago - 18.9 million downloads total - 292 stars on GitHub - 1 maintainer
awssdk.cloudformation 3.7.307
AWS CloudFormation gives developers and systems administrators an easy way to create and manage a...
993 versions - Latest release: 30 days ago - 18.7 million downloads total - 2,005 stars on GitHub - 1 maintainer
amazon.lambda.aspnetcoreserver 9.0.0
Amazon.Lambda.AspNetCoreServer makes it easy to run ASP.NET Core Web API applications as AWS Lamb...
50 versions - Latest release: 3 months ago - 16.9 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.kinesisfirehose 3.7.304
Amazon Kinesis Firehose is a fully managed service for ingesting data streams directly into AWS d...
962 versions - Latest release: 3 months ago - 16.6 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.lambda.applicationloadbalancerevents 2.2.0
Amazon Lambda .NET Core support - Application Load Balancer package.
4 versions - Latest release: 7 months ago - 15.9 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.stepfunctions 3.7.302
AWS Step Functions is a web service that enables you to coordinate a network of computing resourc...
896 versions - Latest release: 6 months ago - 15.4 million downloads total - 1,999 stars on GitHub - 1 maintainer
awssdk.cloudfront 3.7.302
Amazon CloudFront is a content delivery web service. It integrates with other Amazon Web Services...
988 versions - Latest release: about 1 month ago - 14.6 million downloads total - 2,005 stars on GitHub - 1 maintainer
awsxrayrecorder.handlers.awssdk 2.12.0
This package contains libraries to trace AWSSDK requests.
29 versions - Latest release: about 1 year ago - 13.8 million downloads total - 1 maintainer
awssdk.rds 3.7.312
Amazon Relational Database Service (Amazon RDS) is a web service that makes it easy to set up, op...
1,063 versions - Latest release: 16 days ago - 13.6 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.ecs 3.7.305
Amazon EC2 Container Service is a highly scalable, high performance container management service ...
1,014 versions - Latest release: 4 months ago - 13.5 million downloads total - 2,005 stars on GitHub - 1 maintainer
Top 0.7% on nuget.org
amazon.lambda.testutilities 2.0.0
Amazon.Lambda.TestUtilties includes stub implementations of interfaces defined in Amazon.Lambda.C...
4 versions - Latest release: about 3 years ago - 10 dependent packages - 520 dependent repositories - 13.4 million downloads total - 1 maintainer
awssdk.xray 3.7.300
AWS X-Ray helps developers analyze and debug distributed applications. With X-Ray, you can unders...
931 versions - Latest release: 6 months ago - 13.3 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk 2.3.55
This is the previous version 2 generation of the AWS SDK for .NET. The new version 3 of the AWS S...
248 versions - Latest release: about 8 years ago - 11.3 million downloads total - 1 maintainer
awssdk.sso 3.7.300
This is an initial release of AWS Single Sign-On (SSO) end-user access. This release adds support...
745 versions - Latest release: 6 months ago - 11.3 million downloads total - 2,005 stars on GitHub - 1 maintainer
serilog.sinks.awscloudwatch 4.2.25
A Serilog sink that logs to AWS CloudWatch
52 versions - Latest release: about 1 month ago - 11.2 million downloads total - 61 stars on GitHub - 1 maintainer
awssdk.ssooidc 3.7.301
This is an initial release of AWS Single Sign-On OAuth device code authorization service.
746 versions - Latest release: 6 months ago - 11.1 million downloads total - 2,007 stars on GitHub - 1 maintainer
awsxrayrecorder.handlers.system.net 2.11.0
This package contains libraries to trace WebRequest from System.Net namespace.
28 versions - Latest release: about 1 year ago - 11 million downloads total - 1 maintainer
awssdk.eventbridge 3.7.302
Amazon EventBridge is a serverless event bus service that makes it easy to connect your applicati...
802 versions - Latest release: 4 months ago - 10.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.appconfigdata 3.7.301
AWS AppConfig Data is a new service that allows you to retrieve configuration deployed by AWS App...
437 versions - Latest release: 4 months ago - 10.4 million downloads total - 2,005 stars on GitHub - 1 maintainer
awsxrayrecorder.handlers.aspnetcore 2.11.0
This package contains libraries to trace ASP.NET Core Web requests.
23 versions - Latest release: about 1 year ago - 10.4 million downloads total - 1 maintainer
awssdk.athena 3.7.303
This release adds support for Amazon Athena. Amazon Athena is an interactive query service that m...
918 versions - Latest release: 4 months ago - 10.2 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.ecr 3.7.302
Amazon EC2 Container Registry (Amazon ECR) is a managed AWS Docker registry service. Customers ca...
963 versions - Latest release: 4 days ago - 9.85 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.autoscaling 3.7.302
Auto Scaling helps you maintain application availability and allows you to scale your capacity up...
981 versions - Latest release: 3 months ago - 9.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.lambda.dynamodbevents 3.1.1
Amazon Lambda .NET Core support - DynamoDBEvents package.
12 versions - Latest release: 2 months ago - 9.59 million downloads total - 1,529 stars on GitHub - 1 maintainer
awssdk.elasticache 3.7.302
ElastiCache is a web service that makes it easy to deploy, operate, and scale an in-memory cache ...
973 versions - Latest release: about 2 months ago - 9.38 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.apigateway 3.7.300
Amazon API Gateway helps developers deliver robust, secure and scalable mobile and web applicatio...
983 versions - Latest release: 6 months ago - 9.21 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.route53 3.7.302
Amazon Route 53 is a highly available and scalable cloud Domain Name System (DNS) web service.
985 versions - Latest release: 4 months ago - 9.06 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.certificatemanager 3.7.300
AWS Certificate Manager (ACM) is an AWS service that makes it easier for you to deploy secure SSL...
962 versions - Latest release: 6 months ago - 8.52 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdkcpp-core 1.6.25
The AWS SDK for C++ provides a modern C++ (version C++ 11 or later) interface for Amazon Web Serv...
216 versions - Latest release: over 5 years ago - 8.41 million downloads total - 1,866 stars on GitHub - 2 maintainers
awssdk.elasticloadbalancingv2 3.7.302
Elastic Load Balancing automatically distributes incoming application traffic across multiple com...
958 versions - Latest release: 3 months ago - 8.3 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.cloudwatchevents 3.7.300
Amazon CloudWatch Events helps you to respond to state changes in your AWS resources. When your r...
955 versions - Latest release: 6 months ago - 8.1 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.secretsmanager.caching 1.0.6
The AWS Secrets Manager .NET caching client enables in-process caching of secrets for C# applicat...
7 versions - Latest release: 11 months ago - 8.07 million downloads total - 52 stars on GitHub - 1 maintainer
amazon.lambda.snsevents 2.1.0
Amazon Lambda .NET Core support - SNSEvents package.
5 versions - Latest release: 7 months ago - 8.03 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.appconfig 3.7.301
Introducing AWS AppConfig, a new service that enables customers to quickly deploy validated confi...
746 versions - Latest release: 2 months ago - 7.55 million downloads total - 2,007 stars on GitHub - 1 maintainer
aws.logger.aspnetcore 3.5.1
An AWS implementation of ASP.NET Core ILogger that records logging messages to Amazon CloudWatch ...
27 versions - Latest release: 20 days ago - 7.51 million downloads total - 292 stars on GitHub - 1 maintainer
amazon.extensions.cognitoauthentication 2.5.4
An extension library to assist in the Amazon Cognito User Pools authentication process.
25 versions - Latest release: 9 days ago - 7.35 million downloads total - 102 stars on GitHub - 1 maintainer
awssdk.elasticmapreduce 3.7.304
Amazon Elastic MapReduce (Amazon EMR) is a web service that makes it easy to quickly and cost-eff...
970 versions - Latest release: 3 months ago - 7.07 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.applicationautoscaling 3.7.301
Application Auto Scaling is a general purpose Auto Scaling service for supported elastic AWS reso...
964 versions - Latest release: 5 months ago - 7.01 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.cloudtrail 3.7.304
AWS CloudTrail is a web service that records AWS API calls for your account and delivers log file...
967 versions - Latest release: 2 months ago - 6.97 million downloads total - 2,005 stars on GitHub - 1 maintainer
amazon.lambda.runtimesupport 1.10.0
Provides a bootstrap and Lambda Runtime API Client to help you to develop custom .NET Core Lambda...
21 versions - Latest release: 7 months ago - 6.89 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.glue 3.7.310
AWS Glue is a fully managed extract, transform, and load (ETL) service that makes it easy for cus...
954 versions - Latest release: 23 days ago - 6.88 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.translate 3.7.300
Public preview release of Amazon Translate and the Amazon Translate Developer Guide. For more inf...
909 versions - Latest release: 6 months ago - 6.84 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.elasticloadbalancing 3.7.300
Elastic Load Balancing automatically distributes incoming application traffic across multiple com...
928 versions - Latest release: 6 months ago - 6.82 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.elasticbeanstalk 3.7.300
AWS Elastic Beanstalk is an easy-to-use service for deploying and scaling web applications and se...
969 versions - Latest release: 6 months ago - 6.8 million downloads total - 2,005 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
amazon.lambda.s3events 3.1.0
Amazon Lambda .NET Core support - S3Events package.
11 versions - Latest release: 7 months ago - 6.71 million downloads total - 1,530 stars on GitHub - 1 maintainer
awssdk.redshift 3.7.305
Amazon Redshift is a fast, fully managed, petabyte-scale data warehouse solution that makes it si...
976 versions - Latest release: 30 days ago - 6.53 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.elasticfilesystem 3.7.302
Amazon Elastic File System (Amazon EFS) is a file storage service for Amazon Elastic Compute Clou...
963 versions - Latest release: 6 months ago - 6.38 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.apigatewayv2 3.7.300
This is the initial SDK release for the Amazon API Gateway v2 APIs. This SDK will allow you to ma...
864 versions - Latest release: 6 months ago - 6.36 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.configservice 3.7.302
AWS Config is a fully managed service that provides you with an AWS resource inventory, configura...
1,001 versions - Latest release: 4 months ago - 6.29 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.s3control 3.7.305
Add support for new S3 Block Public Access account-level APIs. The Block Public Access settings a...
885 versions - Latest release: 4 months ago - 6.27 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.workspaces 3.7.303
Amazon WorkSpaces is a managed desktop computing service in the cloud.
968 versions - Latest release: 24 days ago - 6.27 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.sagemaker 3.7.320
Amazon SageMaker is a fully-managed service that enables data scientists and developers to quickl...
976 versions - Latest release: 12 days ago - 6.23 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.wafv2 3.7.304
This release introduces new set of APIs (wafv2) for AWS WAF. Major changes include single set of ...
745 versions - Latest release: about 1 month ago - 6.2 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.transfer 3.7.306
AWS Transfer for SFTP is a fully managed service that enables transfer of secure data over the in...
886 versions - Latest release: 20 days ago - 6.15 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.databasemigrationservice 3.7.301
AWS Database Migration Service (AWS DMS) can migrate your data to and from most widely used comme...
964 versions - Latest release: 6 months ago - 6.09 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.organizations 3.7.302
AWS Organizations is a web service that enables you to consolidate your multiple AWS accounts int...
938 versions - Latest release: 2 months ago - 6.06 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.elasticsearch 3.7.302
Use the Amazon Elasticsearch configuration API to create, configure, and manage Elasticsearch dom...
961 versions - Latest release: 3 months ago - 6.03 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.marketplaceentitlementservice 3.7.301
AWS Marketplace Entitlement Service enables AWS Marketplace sellers to determine the capacity pur...
906 versions - Latest release: 6 months ago - 6 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.transcribeservice 3.7.303
Amazon Transcribe Public Preview Release
920 versions - Latest release: 13 days ago - 5.92 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.storagegateway 3.7.301
The AWS Storage Gateway is a service connecting an on-premises software appliance with cloud-base...
982 versions - Latest release: 4 months ago - 5.92 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.mq 3.7.300
This is the initial SDK release for Amazon MQ. Amazon MQ is a managed message broker service for ...
907 versions - Latest release: 6 months ago - 5.91 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.aspnetcore.dataprotection.ssm 3.2.1
AWS Systems Manager ASP.NET Core Data Protection Provider library allows you to use AWS Systems M...
10 versions - Latest release: 22 days ago - 5.89 million downloads total - 55 stars on GitHub - 1 maintainer
awssdk.route53domains 3.7.301
Amazon Route 53 is a highly available and scalable cloud Domain Name System (DNS) web service.
961 versions - Latest release: 3 months ago - 5.79 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.inspector 3.7.300
Amazon Inspector identifies security issues in your application deployments.
931 versions - Latest release: 6 months ago - 5.76 million downloads total - 1,999 stars on GitHub - 1 maintainer
awssdk.kafka 3.7.302
Amazon Managed Streaming for Kafka (Amazon MSK). Amazon MSK is a service that you can use to easi...
879 versions - Latest release: 2 months ago - 5.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.shield 3.7.300
AWS Shield protects web applications from large and sophisticated DDoS attacks at Layer 3, 4 and ...
934 versions - Latest release: 6 months ago - 5.69 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.guardduty 3.7.306
Enable Amazon GuardDuty to continuously monitor and process AWS data sources to identify threats ...
916 versions - Latest release: 24 days ago - 5.63 million downloads total - 2,005 stars on GitHub - 1 maintainer
Top 2.7% on nuget.org
awssdkcpp-core.redist 1.6.25
Redistributable components for package 'AWSSDKCPP-Core'. This package should only be installed as...
217 versions - Latest release: over 5 years ago - 1 dependent package - 7 dependent repositories - 5.59 million downloads total - 1,866 stars on GitHub - 2 maintainers
amazon.lambda.cloudwatchevents 4.4.0
Amazon Lambda .NET Core support - CloudWatchEvents package.
10 versions - Latest release: 7 months ago - 5.57 million downloads total - 1,530 stars on GitHub - 1 maintainer
foundatio 10.7.1 💰
Pluggable foundation blocks for building distributed apps.
462 versions - Latest release: about 2 months ago - 5.5 million downloads total - 1,911 stars on GitHub - 1 maintainer
awssdk.wafregional 3.7.300
AWS WAF (Web Application Firewall) Regional protects web applications from attack via ALB load ba...
926 versions - Latest release: 6 months ago - 5.49 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.securityhub 3.7.304
AWS Security Hub provides you with a comprehensive view of your security state within AWS and you...
886 versions - Latest release: about 2 months ago - 5.45 million downloads total - 2,006 stars on GitHub - 1 maintainer