Ecosyste.ms: Packages

An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.

nuget.org "Amazon" keyword

awssdkcpp-signer.redist 1.6.20170825.25
Redistributable components for package 'AWSSDKCPP-Signer'. This package should only be installed ...
5 versions - Latest release: over 5 years ago - 1 dependent package - 5.26 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
lambdajection 0.9.2 💰
Write AWS Lambda Functions using Dependency Injection.
51 versions - Latest release: over 2 years ago - 36.3 thousand downloads total - 16 stars on GitHub - 1 maintainer
aspnetcore.pulse.aws.sns
Pulse.Aws.Sns is the health check package for Amazon Simple Notification Service.
5 versions - 228 downloads total - 3,932 stars on GitHub - 1 maintainer
elcamino.aspnet.identity.dynamo 1.1.1
DynamoDB Storage Provider for ASP.NET Identity 2.0 framework
7 versions - Latest release: over 9 years ago - 1 dependent repositories - 27 thousand downloads total - 1 maintainer
Top 7.2% on nuget.org
awssdkcpp-lexruntimeservice 1.6.20161128.25
Amazon Lex Runtime Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ ...
165 versions - Latest release: over 5 years ago - 382 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-cloudhsm 1.6.20140530.25
Amazon CloudHSM Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C+...
221 versions - Latest release: over 5 years ago - 273 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-core.symbols 0.12.12
Symbols for package 'AWSSDKCPP-Core'. This package should not likely be installed. (This is not ...
1 version - Latest release: almost 8 years ago - 1.37 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
akka.streams.kinesis 1.5.18
AWS Kinesis adapter for Akka.NET Streams
20 versions - Latest release: 2 months ago - 5.08 thousand downloads total - 107 stars on GitHub - 1 maintainer
Top 5.4% on nuget.org
awssdkcpp-dynamodbstreams.redist 1.6.20120810.25
Redistributable components for package 'AWSSDKCPP-DynamoDBStreams'. This package should only be i...
134 versions - Latest release: over 5 years ago - 1 dependent package - 164 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-snowball 1.6.20160630.25
Amazon Import/Export Snowball Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C...
202 versions - Latest release: over 5 years ago - 418 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
akka.streams.sqs 1.5.18
Amazon SQS adapter for Akka.NET Streams
20 versions - Latest release: 2 months ago - 11.2 thousand downloads total - 107 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-iot 1.6.20150528.25
AWS IoT Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 11 or ...
220 versions - Latest release: over 5 years ago - 949 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-ecr 1.6.20150921.25
Amazon EC2 Container Registry Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C...
220 versions - Latest release: over 5 years ago - 282 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
kuboestudio.amazons3 1.0.6
Wrapper to interact with the AmazonS3 Storage.
7 versions - Latest release: almost 8 years ago - 8.68 thousand downloads total - 1 maintainer
nitro.email 1.0.0
A new age customized nuget to help developers configure emailing service with ease and quickly fo...
1 version - Latest release: about 5 years ago - 628 downloads total - 1 maintainer
Top 5.3% on nuget.org
awssdkcpp-clouddirectory.redist 1.6.20170111.25
Redistributable components for package 'AWSSDKCPP-CloudDirectory'. This package should only be in...
169 versions - Latest release: over 5 years ago - 1 dependent package - 222 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-elasticbeanstalk 1.6.20101201.25
AWS Elastic Beanstalk Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (vers...
220 versions - Latest release: over 5 years ago - 290 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
delay.web.helpers 1.1.1
Delay.Web.Helpers is an ASP.NET web helper assembly that includes support for Amazon Simple Stora...
3 versions - Latest release: about 13 years ago - 1 dependent package - 17.8 thousand downloads total - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-codedeploy 1.6.20141006.25
AWS CodeDeploy Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++...
220 versions - Latest release: over 5 years ago - 288 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 8.7% on nuget.org
abrain.amazonmws 1.1.0
ABrain.AmazonMWS is Wrapper of Amazon MWS API
32 versions - Latest release: almost 4 years ago - 9 dependent repositories - 183 thousand downloads total - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-directconnect 1.6.20121025.25
AWS Direct Connect Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version...
220 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
kalarrs.serverless.netcore.util 1.0.3
Serverless Framework .NET Core support - Util package.
4 versions - Latest release: almost 6 years ago - 1 dependent repositories - 5.1 thousand downloads total - 0 stars on GitHub - 1 maintainer
Top 5.8% on nuget.org
awssdkcpp-cognitoidentityprovider 1.6.20160418.25
Amazon Cognito Identity Provider Client for the AWS SDK for C++. AWS SDK for C++ provides a moder...
219 versions - Latest release: over 5 years ago - 2 dependent repositories - 318 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-cloudsearchdomain 1.6.20130101.25
Amazon CloudSearch Domain Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (...
221 versions - Latest release: over 5 years ago - 265 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-cloudsearch 1.6.20130101.25
Amazon CloudSearch Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version...
220 versions - Latest release: over 5 years ago - 286 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 6.2% on nuget.org
awssdkcpp-sqs 1.6.20121105.25
Amazon Simple Queue Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++...
218 versions - Latest release: over 5 years ago - 1 dependent repositories - 311 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.8% on nuget.org
awssdkcpp-ses 1.6.20101201.25
Amazon Simple Email Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++...
219 versions - Latest release: over 5 years ago - 2 dependent repositories - 358 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-workspaces 1.6.20150408.25
Amazon WorkSpaces Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version ...
218 versions - Latest release: over 5 years ago - 259 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
ndashbutton 1.0.1
This is a simple listener of Amazon Dash Button requests. It fires an event when a button in the ...
2 versions - Latest release: almost 7 years ago - 1.78 thousand downloads total - 0 stars on GitHub - 1 maintainer
awssdkcpp-acm.symbols 0.12.20151208.12
Symbols for package 'AWSSDKCPP-ACM'. This package should not likely be installed. (This is not t...
1 version - Latest release: almost 8 years ago - 1.24 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.1% on nuget.org
awssdkcpp-identitymanagement.redist 1.6.25
Redistributable components for package 'AWSSDKCPP-IdentityManagement'. This package should only b...
135 versions - Latest release: over 5 years ago - 1 dependent package - 2 dependent repositories - 172 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-cloudhsm.symbols 0.12.20140530.12
Symbols for package 'AWSSDKCPP-CloudHSM'. This package should not likely be installed. (This is ...
1 version - Latest release: almost 8 years ago - 1.27 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-opsworks.redist 1.6.20130218.25
Redistributable components for package 'AWSSDKCPP-OpsWorks'. This package should only be installe...
220 versions - Latest release: over 5 years ago - 1 dependent package - 309 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 10.0% on nuget.org
nfx.mongodb 3.5.0
NFX.MongoDB Provider Package NFX UNISTACK includes: Application Container +...
5 versions - Latest release: almost 7 years ago - 1 dependent repositories - 9.72 thousand downloads total - 389 stars on GitHub - 1 maintainer
awssdkcpp-swf.symbols 0.12.20120125.12
Symbols for package 'AWSSDKCPP-SWF'. This package should not likely be installed. (This is not t...
1 version - Latest release: almost 8 years ago - 1.27 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.3% on nuget.org
awssdkcpp-dynamodbstreams 1.6.20120810.25
Amazon DynamoDB Streams Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
134 versions - Latest release: over 5 years ago - 144 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-elasticsearchservice 1.6.20150101.25
Amazon Elasticsearch Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C+...
220 versions - Latest release: over 5 years ago - 262 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-codepipeline 1.6.20150709.25
AWS CodePipeline Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C...
220 versions - Latest release: over 5 years ago - 278 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
cksource.filesystem.amazon 1.1.3
An Amazon S3 file system
5 versions - Latest release: about 5 years ago - 1 dependent package - 19 dependent repositories - 166 thousand downloads total - 1 maintainer
Top 7.4% on nuget.org
awssdk.core 3.7.304
The Amazon Web Services SDK for .NET - Core Runtime
1,073 versions - Latest release: 23 days ago - 670 dependent packages - 810 million downloads total - 2,008 stars on GitHub - 1 maintainer
Top 5.9% on nuget.org
awssdkcpp-autoscalingplans.redist 1.6.20180106.25
Redistributable components for package 'AWSSDKCPP-AutoScalingPlans'. This package should only be ...
57 versions - Latest release: over 5 years ago - 1 dependent package - 67 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
emailhelperpackage 2.0.0
Package contains methods to send email using SMTP and third party email providers according to us...
3 versions - Latest release: almost 6 years ago - 3.13 thousand downloads total - 1 maintainer
quartznet-dynamodb 1.3.118
This library provides a fully functioning Amazon DynamoDB JobStore for Quartz.NET using the AWS S...
26 versions - Latest release: almost 7 years ago - 24 thousand downloads total - 8 stars on GitHub - 2 maintainers
asmodat.awswrapper 1.0.5
Amazon Web Services .NET Standard Extensions for NET 5.0
53 versions - Latest release: over 3 years ago - 1 dependent package - 1 dependent repositories - 42.5 thousand downloads total - 0 stars on GitHub - 1 maintainer
Top 7.6% on nuget.org
awssdkcpp-mediastore 1.6.20170901.25
AWS Elemental MediaStore Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (v...
73 versions - Latest release: over 5 years ago - 76.2 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-cloudwatchevents 1.6.20151007.25
Amazon CloudWatch Events Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (v...
221 versions - Latest release: over 5 years ago - 278 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.4% on nuget.org
awssdkcpp-transfer.redist 1.6.25
Redistributable components for package 'AWSSDKCPP-Transfer'. This package should only be installe...
134 versions - Latest release: over 5 years ago - 1 dependent package - 1 dependent repositories - 184 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 2.5% on nuget.org
nfx 3.5.0
NFX CORE Package NFX UNISTACK includes: Application Container + Dependency Injection facili...
43 versions - Latest release: almost 7 years ago - 8 dependent packages - 6 dependent repositories - 192 thousand downloads total - 389 stars on GitHub - 1 maintainer
Top 6.1% on nuget.org
awssdkcpp-dynamodb 1.6.20120810.25
Amazon DynamoDB Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C+...
220 versions - Latest release: over 5 years ago - 1 dependent repositories - 749 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.7% on nuget.org
awssdkcpp-pricing.redist 1.6.20171015.25
Redistributable components for package 'AWSSDKCPP-Pricing'. This package should only be installed...
79 versions - Latest release: over 5 years ago - 1 dependent package - 93.7 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-configservice 1.6.20141112.25
AWS Config Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 11 ...
219 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 9.2% on nuget.org
amazonclouddriveapi 1.5.5 💰
General implementation of REST API for Amazon Cloud Drive. Not all functions are implemented, but...
31 versions - Latest release: about 7 years ago - 1 dependent repositories - 39.9 thousand downloads total - 24 stars on GitHub - 1 maintainer
Top 5.2% on nuget.org
awssdkcpp-elasticloadbalancing.redist 1.6.20120601.25
Redistributable components for package 'AWSSDKCPP-ElasticLoadBalancing'. This package should only...
220 versions - Latest release: over 5 years ago - 1 dependent package - 304 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-elasticsearchservice.symbols 0.12.20150101.12
Symbols for package 'AWSSDKCPP-ElasticsearchService'. This package should not likely be installed...
1 version - Latest release: almost 8 years ago - 1.28 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 0.7% on nuget.org
amazon.lambda.testutilities 2.0.0
Amazon.Lambda.TestUtilties includes stub implementations of interfaces defined in Amazon.Lambda.C...
4 versions - Latest release: about 3 years ago - 10 dependent packages - 520 dependent repositories - 13.7 million downloads total - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-machinelearning 1.6.20141212.25
Amazon Machine Learning Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
219 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
lambdajection.encryption 0.9.2 💰
Provides an attribute and decryption service for encrypted configuration options that are injecte...
42 versions - Latest release: over 2 years ago - 1 dependent package - 26.7 thousand downloads total - 16 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-elastictranscoder 1.6.20120925.25
Amazon Elastic Transcoder Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (...
219 versions - Latest release: over 5 years ago - 265 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-ssm 1.6.20141106.25
Amazon Simple Systems Manager (SSM) Client for the AWS SDK for C++. AWS SDK for C++ provides a mo...
212 versions - Latest release: over 5 years ago - 335 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-autoscaling 1.6.20110101.25
Auto Scaling Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 1...
221 versions - Latest release: over 5 years ago - 301 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.2% on nuget.org
awssdkcpp-machinelearning.redist 1.6.20141212.25
Redistributable components for package 'AWSSDKCPP-MachineLearning'. This package should only be i...
220 versions - Latest release: over 5 years ago - 1 dependent package - 292 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
nfx.mssql 3.5.0
NFX Microsoft SQL Server Provider Package NFX UNISTACK includes: Applicatio...
5 versions - Latest release: almost 7 years ago - 10.6 thousand downloads total - 389 stars on GitHub - 1 maintainer
Top 5.7% on nuget.org
awssdkcpp-mediapackage.redist 1.6.20171012.25
Redistributable components for package 'AWSSDKCPP-MediaPackage'. This package should only be inst...
73 versions - Latest release: over 5 years ago - 1 dependent package - 83.3 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 9.2% on nuget.org
awssdkcpp-guardduty.redist 1.6.20171128.25
Redistributable components for package 'AWSSDKCPP-GuardDuty'. This package should only be install...
73 versions - Latest release: over 5 years ago - 1 dependent package - 82.6 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 8.3% on nuget.org
mapsuitedependency-awssdkdynamodbv2 10.2.0
"Amazon DynamoDB is a fast and flexible NoSQL database service for all applications that need con...
1 version - Latest release: over 124 years ago - 1,893 stars on GitHub
Top 5.7% on nuget.org
awssdkcpp-resourcegroups.redist 1.6.20171127.25
Redistributable components for package 'AWSSDKCPP-ResourceGroups'. This package should only be in...
73 versions - Latest release: over 5 years ago - 1 dependent package - 84.2 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-route53domains 1.6.20140515.25
Amazon Route 53 Domains Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
220 versions - Latest release: over 5 years ago - 270 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
akka.streams.sns 1.5.18
Amazon SNS adapter for Akka.NET Streams
20 versions - Latest release: 2 months ago - 4.03 thousand downloads total - 107 stars on GitHub - 1 maintainer
Top 5.3% on nuget.org
awssdkcpp-lexruntimeservice.redist 1.6.20161128.25
Redistributable components for package 'AWSSDKCPP-LexRuntimeService'. This package should only be...
165 versions - Latest release: over 5 years ago - 1 dependent package - 352 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 3.7% on nuget.org
awssdkcpp-sts.redist 1.6.20110615.25
Redistributable components for package 'AWSSDKCPP-STS'. This package should only be installed as ...
219 versions - Latest release: over 5 years ago - 1 dependent package - 3 dependent repositories - 340 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-configservice.redist 1.6.20141112.25
Redistributable components for package 'AWSSDKCPP-ConfigService'. This package should only be ins...
220 versions - Latest release: over 5 years ago - 1 dependent package - 291 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
framework.4.5.aws.ext.cognitoauth 1.0.4
An extension library to assist in the Amazon Cognito User Pools authentication process.
1 version - Latest release: over 3 years ago - 3.25 thousand downloads total - 0 stars on GitHub - 1 maintainer
awssdkcpp-importexport.symbols 0.12.20100601.12
Symbols for package 'AWSSDKCPP-ImportExport'. This package should not likely be installed. (This...
1 version - Latest release: almost 8 years ago - 1.21 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.2% on nuget.org
awssdkcpp-ecr.redist 1.6.20150921.25
Redistributable components for package 'AWSSDKCPP-ECR'. This package should only be installed as ...
220 versions - Latest release: over 5 years ago - 1 dependent package - 303 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.5% on nuget.org
nager.articlenumber 1.0.7 💰
Validate article numbers (EAN8, EAN13, GTIN, ISBN10, ISBN13, ISSN, UPC, ASIN). Detect the article...
8 versions - Latest release: over 2 years ago - 2 dependent packages - 4 dependent repositories - 198 thousand downloads total - 31 stars on GitHub - 1 maintainer
Top 7.6% on nuget.org
awssdkcpp-alexaforbusiness 1.6.20171109.25
Alexa For Business Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version...
73 versions - Latest release: over 5 years ago - 91.5 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-route53 1.6.20130401.25
Amazon Route 53 Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C+...
220 versions - Latest release: over 5 years ago - 292 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.3% on nuget.org
awssdkcpp-athena 1.6.20170518.25
Amazon Athena Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ ...
134 versions - Latest release: over 5 years ago - 155 thousand downloads total - 1,808 stars on GitHub - 1 maintainer
lambdajection.core 0.9.2 💰
Includes interfaces and runtime support classes for writing AWS Lambdas using Dependency Injection.
50 versions - Latest release: over 2 years ago - 4 dependent packages - 45.4 thousand downloads total - 16 stars on GitHub - 1 maintainer
Top 3.0% on nuget.org
amazon.elasticachecluster 1.0.1
A configuration object to enable auto discovery in Enyim for ElastiCache
6 versions - Latest release: over 6 years ago - 6 dependent packages - 12 dependent repositories - 1.07 million downloads total - 29 stars on GitHub - 1 maintainer
aws-mobile-sdk-xamarin-beta 4.1.0
Please use the new AWS SDK for .NET with Xamarin SDK in Developer Preview: See links below: http...
7 versions - Latest release: over 124 years ago - 45 stars on GitHub
Top 5.3% on nuget.org
awssdkcpp-route53domains.redist 1.6.20140515.25
Redistributable components for package 'AWSSDKCPP-Route53Domains'. This package should only be in...
220 versions - Latest release: over 5 years ago - 1 dependent package - 302 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.2% on nuget.org
awssdkcpp-iam 1.6.20100508.25
AWS Identity and Access Management Client for the AWS SDK for C++. AWS SDK for C++ provides a mod...
218 versions - Latest release: over 5 years ago - 1 dependent package - 1 dependent repositories - 435 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 6.7% on nuget.org
awssdkcpp-macie.redist 1.6.20171219.25
Redistributable components for package 'AWSSDKCPP-Macie'. This package should only be installed a...
24 versions - Latest release: over 5 years ago - 1 dependent package - 24.9 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
nfx.wave 3.5.0
NFX.Wave Web Server Framework Package NFX UNISTACK includes: Application Co...
5 versions - Latest release: almost 7 years ago - 14.8 thousand downloads total - 389 stars on GitHub - 1 maintainer
Top 8.6% on nuget.org
awssdkcpp-macie 1.6.20171219.25
Amazon Macie Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 1...
24 versions - Latest release: over 5 years ago - 22.3 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 8.7% on nuget.org
awssdkcpp-dlm 1.6.20180112.25
Amazon Data Lifecycle Manager Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C...
21 versions - Latest release: over 5 years ago - 20.3 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-iam.symbols 0.12.20100508.12
Symbols for package 'AWSSDKCPP-IAM'. This package should not likely be installed. (This is not t...
1 version - Latest release: almost 8 years ago - 1.29 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
mcpelee.owin.security.amazon 1.0.0
Middleware that enables an application to support Amazon's OAuth 2.0 authentication workflow.
1 version - Latest release: about 7 years ago - 979 downloads total - 0 stars on GitHub - 1 maintainer
Top 5.3% on nuget.org
awssdkcpp-importexport.redist 1.6.20100601.25
Redistributable components for package 'AWSSDKCPP-ImportExport'. This package should only be inst...
220 versions - Latest release: over 5 years ago - 1 dependent package - 297 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
easydynamo 1.1.6
EasyDynamo is a small library that helps developers to access and configure DynamoDB easier. Diff...
17 versions - Latest release: over 4 years ago - 274 thousand downloads total - 1 maintainer
Top 7.2% on nuget.org
awssdkcpp-xray 1.6.20160412.25
AWS X-Ray Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 11 o...
179 versions - Latest release: over 5 years ago - 206 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
slight.alexa 1.0.27
A set of managed C# models and helpers to integrate Amazon's Alexa skill services into your .Net ...
7 versions - Latest release: over 7 years ago - 1 dependent repositories - 8.79 thousand downloads total - 14 stars on GitHub - 1 maintainer
Top 7.3% on nuget.org
awssdkcpp-marketplaceentitlementservice 1.6.20170111.25
AWS Marketplace Entitlement Service Client for the AWS SDK for C++. AWS SDK for C++ provides a mo...
112 versions - Latest release: over 5 years ago - 152 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.0% on nuget.org
milestonetg.extensions.configuration.s3 1.2.0
.NET Configuration Extensions for loading configuration files from AWS S3.
4 versions - Latest release: over 4 years ago - 2 dependent packages - 91.9 thousand downloads total - 2 stars on GitHub - 1 maintainer
xamarin.cloudrail.android 1.2.12
CloudRail is an API integration solution which abstracts multiple APIs from different providers i...
12 versions - Latest release: over 124 years ago - 15 thousand downloads total - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-datapipeline 1.6.20121029.25
AWS Data Pipeline Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version ...
219 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
kalarrs.lambda.serialization.json 1.3.3
Amazon Lambda .NET Core support - Serialization.Json package.
4 versions - Latest release: almost 6 years ago - 1 dependent repositories - 7.53 thousand downloads total - 0 stars on GitHub - 1 maintainer
delay.web.helpers.samplewebsite 1.1.1
Sample web site for the Delay.Web.Helpers package.
3 versions - Latest release: about 13 years ago - 6.71 thousand downloads total - 1 maintainer
Top 5.5% on nuget.org
awssdkcpp-cloudhsmv2.redist 1.6.20170428.25
Redistributable components for package 'AWSSDKCPP-CloudHSMV2'. This package should only be instal...
113 versions - Latest release: over 5 years ago - 1 dependent package - 143 thousand downloads total - 1,866 stars on GitHub - 1 maintainer