Ecosyste.ms: Packages

An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.

nuget.org "MVC" keyword

chekkan.mvcseed 1.1.3
Adds models and data layer to an MVC Web Project
5 versions - Latest release: over 10 years ago - 6.59 thousand downloads total - 0 stars on GitHub - 1 maintainer
flitbit.ioc.web.common 1.2.4
Shared functionality for the .net web stack (Mvc, WebApi, SignalR, Etc) for FlitBit.IoC framework.
11 versions - Latest release: over 10 years ago - 2 dependent packages - 4 dependent repositories - 18.8 thousand downloads total - 0 stars on GitHub - 1 maintainer
contentinjector.wof 0.1.0
Extends Content Injector for ASP.NET MVC with support for Microsoft's Web Optimization Framework.
1 version - Latest release: about 11 years ago - 1.66 thousand downloads total - 0 stars on GitHub - 1 maintainer
smarteditor2inmvc 0.0.1
The Library of the function package that I use personally.
1 version - Latest release: over 124 years ago - 0 stars on GitHub
diassistant 2.1.0
Initial releaseAssistant that will bind all your services, adapters etc. with a single command, w...
3 versions - Latest release: almost 7 years ago - 3.51 thousand downloads total - 0 stars on GitLab.com - 1 maintainer
megacityone.mvc 2.0.7
MegaCityOne MVC 5 libary
17 versions - Latest release: over 8 years ago - 18.5 thousand downloads total - 0 stars on GitHub - 1 maintainer
codo.windsor.mvc 1.0.0
Utilities and helper classes for simplifying configuration of Asp.Net MVC using Castle Windsor.
1 version - Latest release: about 9 years ago - 1.55 thousand downloads total - 0 stars on GitHub - 1 maintainer
helpfulthings.quickbootstrapforms.datepicker 1.0.4
This package provides some helpful HtmlHelper extensions for quickly building forms the bootstrap...
3 versions - Latest release: over 5 years ago - 2.67 thousand downloads total - 0 stars on GitHub - 1 maintainer
jctools.shortener 1.1.2
A simple links shortener for include in .net core projects
5 versions - Latest release: over 3 years ago - 2.19 thousand downloads total - 0 stars on GitHub - 1 maintainer
moca.netwebmvc 2.0.0
DI with AOP framework Moca.NET Web MVC
4 versions - Latest release: about 9 years ago - 3.53 thousand downloads total - 0 stars on GitHub - 2 maintainers
scmvc 0.4.13
Better MVC support for Sitecore CMS
20 versions - Latest release: over 9 years ago - 22.6 thousand downloads total - 0 stars on GitHub - 1 maintainer
viewscript 0.1.0-alpha
ViewScript
1 version - Latest release: over 124 years ago - 0 stars on GitHub
codecomb.security.aes 2.0.0-rc1-final
ASP.Net vNext AES Crypto Library
2 versions - Latest release: over 8 years ago - 0 stars on GitHub
ninject.webcontext 1.1.3
Smart IoC library for your WebApp
6 versions - Latest release: over 8 years ago - 1 dependent repositories - 7.42 thousand downloads total - 0 stars on GitHub - 1 maintainer
ssw.sqlverify.ef 1.0.0
SSW SqlVerify EF provides Entity Framework extension to Sql Verify framework.
1 version - Latest release: about 10 years ago - 1 dependent repositories - 10.2 thousand downloads total - 0 stars on GitHub - 1 maintainer
visualantidote.kentico.mvc.formcomponent.categoryselector 1.0.1
A custom Kentico MVC form component that allows editors to select categories from a list of check...
2 versions - Latest release: over 3 years ago - 1.06 thousand downloads total - 0 stars on GitHub - 1 maintainer
jctools.i18n 2.0.0.2
A simplification of the configuration of location in .net core
2 versions - Latest release: over 6 years ago - 4.77 thousand downloads total - 0 stars on GitHub - 1 maintainer
jo.data 1.0.9
.Net Standard Library 2.0 for Database (mssql)
10 versions - Latest release: over 124 years ago - 0 stars on GitHub
mongodbsessionstateprovider 1.0.0
Proveedor personalizado de Session State basado en MongoDB.
1 version - Latest release: about 9 years ago - 1.68 thousand downloads total - 0 stars on GitHub - 1 maintainer
tssoft.web 1.0.4818.22287
Useful tools for ASP.NET MVC applications. For example, support for DataTables.net jQuery plugin
1 version - Latest release: about 11 years ago - 1 dependent repositories - 1.67 thousand downloads total - 0 stars on GitHub - 1 maintainer
dematt.airy.applicationinsights.owin 1.0.0
Provides Application Insights request and error tracking for both ASP.Net MVC and Web API using O...
3 versions - Latest release: over 7 years ago - 2.94 thousand downloads total - 0 stars on GitHub - 1 maintainer
constellation.mvc 2.0.7280.21261
Uses StructureMap and AutoMapper. Provides the following: - Automatic discovery and execution o...
14 versions - Latest release: over 4 years ago - 14.2 thousand downloads total - 0 stars on GitHub - 1 maintainer
devshed.mvc 1.9.1
Devshed MVC Library
13 versions - Latest release: over 1 year ago - 18.5 thousand downloads total - 0 stars on GitHub - 1 maintainer
cortoxa.web.mvc 1.0.50
Asp.Net Mvc factories for Cortoxa Framework
12 versions - Latest release: almost 10 years ago - 16.3 thousand downloads total - 0 stars on GitHub - 1 maintainer
anarchy 0.0.3-alpha
ASP.NET Core Middleware to simulate errors in your application.
3 versions - Latest release: almost 6 years ago - 0 stars on GitHub
sc.recaptcha.mvc 1.0.3
reCAPTCHA is a free service from Google that helps protect websites from spam and abuse.
4 versions - Latest release: almost 9 years ago - 1 dependent repositories - 7.62 thousand downloads total - 0 stars on GitHub - 1 maintainer
mpsoft.aspnet.grpc.mvcapi.abstractions 1.0.0
MpSoft.AspNet.Grpc.MvcApi is library generating ASP.NET MVC API controllers for the gRPC services.
1 version - Latest release: over 3 years ago - 2 dependent packages - 1.14 thousand downloads total - 0 stars on GitHub - 1 maintainer
Top 9.7% on nuget.org
requirejsnetweboptimization 2.0.1
RequireJS.NET integrates RequireJS script loader with ASP.NET MVC
10 versions - Latest release: almost 7 years ago - 1 dependent package - 1 dependent repositories - 83.7 thousand downloads total - 0 stars on GitHub - 1 maintainer
mpsoft.aspnet.grpc.mvcapi 1.0.0
MpSoft.AspNet.Grpc.MvcApi is library generating ASP.NET MVC API controllers for the gRPC services.
1 version - Latest release: over 3 years ago - 965 downloads total - 0 stars on GitHub - 1 maintainer
kgen.generator 1.5.0.853
provides a code generation tool for generating Message-Wrappers, MVC Controllers (ASP.NET WebAPI)...
13 versions - Latest release: 7 months ago - 10.2 thousand downloads total - 0 stars on GitHub - 1 maintainer
invisual.libraries.mvc.binder 1.2.2
Bind MVC model properties by name. Includes configurable type conversion.
5 versions - Latest release: over 6 years ago - 5 thousand downloads total - 0 stars on GitHub - 1 maintainer
chekkan.mvc5seed 1.0.0
Adds models and data layer to an MVC 5 Web Project
1 version - Latest release: over 10 years ago - 1.76 thousand downloads total - 0 stars on GitHub - 1 maintainer
jmpcoremailer 1.1.8
This is just a small project to send emails from within ASPNET.Core with razor template. See the ...
5 versions - Latest release: over 4 years ago - 3.96 thousand downloads total - 0 stars on GitHub - 1 maintainer
intnovaction.utils.pdfgenerator 0.2.1
Genera pdfs a partir de vistas MVC
3 versions - Latest release: about 7 years ago - 3.28 thousand downloads total - 0 stars on GitHub - 1 maintainer
seventyeightdigital.ckeditor4_wysiwyg.kentico.mvc 1.0.0
Adds CKEditor4 Wysiwyg editor capabilities for MVC. Includes Inline Editor and Widget implementat...
1 version - Latest release: over 4 years ago - 1.1 thousand downloads total - 0 stars on GitHub - 1 maintainer
lessmvcfour 1.0.2
LESS BundleTransform, HttpHandler for integrating with ASP.NET MVC 4
3 versions - Latest release: about 11 years ago - 4.23 thousand downloads total - 0 stars on GitHub - 1 maintainer
fissoft.requirejsnet 1.1.0.23
Change RequireJS.NET to use default.js in controller folder
6 versions - Latest release: over 9 years ago - 7.12 thousand downloads total - 0 stars on GitHub - 1 maintainer
jsmunroe-simplemvc 1.0.1-alpha00024
Facilitates MVC pattern anywhere with optional support for WPF.
16 versions - Latest release: about 8 years ago - 0 stars on GitHub
molimentum.staticmaphelpers 1.0.0
ASP.NET MVC helpers for embedding static maps with the Google Static Maps API V2.
2 versions - Latest release: over 124 years ago - 1 dependent repositories - 2.78 thousand downloads total - 0 stars on GitHub - 1 maintainer
sheleski.delimitedfile.mvc 0.1.0
Helpers for Sheleski.DelimitedFile for ASP.NET MVC.
3 versions - Latest release: over 3 years ago - 888 downloads total - 0 stars on GitHub - 1 maintainer
matchwornshirt.aspnetcore.identity.cosmosdb 3.0.3
Azure CosmosDB Provider to support AspNet Identity Core frameworks for .NET. This package is Mat...
3 versions - Latest release: about 3 years ago - 899 downloads total - 0 stars on GitHub - 1 maintainer
micro.dntbreadcrumb.core 1.9.1.2
DNTBreadCrumb.Core Creates custom bread crumb definitions, based on Twitter Bootstrap 3.x and 4.x...
1 version - Latest release: over 124 years ago - 0 stars on GitHub
jo.basis 1.0.2
.Net Standard Library 2.0 for ASP.NET MVC
3 versions - Latest release: over 124 years ago - 1 dependent package - 0 stars on GitHub
kingdom.aspnet.mvc.core 1.1.0
Core functionality required by ASP.NET MVC bootstrap building blocks.
2 versions - Latest release: over 7 years ago - 3 dependent packages - 3 dependent repositories - 6.53 thousand downloads total - 0 stars on GitHub - 1 maintainer
logeasy.lib 0.0.1
ActionResult - user’s activity logging in asp.net coremvc application | c#
1 version - Latest release: almost 5 years ago - 540 downloads total - 0 stars on GitHub - 1 maintainer
woose.api 1.1.4
.Net7 Library for ASP.NET MVC
18 versions - Latest release: 5 months ago - 1.88 thousand downloads total - 0 stars on GitHub - 1 maintainer
glnn.mvcnavigation 1.0.0
A helper to easely create tabbed navigations or navigations with sub menu's.
1 version - Latest release: over 11 years ago - 2.2 thousand downloads total - 0 stars on GitHub - 1 maintainer
dotnetcasclient.memcached 1.0.2
Memcached backed Proxy/Service Ticket Managers for the Apereo .NET CAS Client.
3 versions - Latest release: about 5 years ago - 1.91 thousand downloads total - 0 stars on GitHub - 1 maintainer
mvcrenderer 1.0.0.2
Custom ASP.Net WebControl to render MVC actions within an ASP.Net WebForms page.
1 version - Latest release: over 7 years ago - 1.19 thousand downloads total - 0 stars on GitHub - 1 maintainer
azurefunctions.worker.extensions.aspnetcore 1.0.10
Package Description
11 versions - Latest release: 30 days ago - 1 dependent package - 1.08 thousand downloads total - 0 stars on GitHub - 1 maintainer
edennis.aspnetcore.utils 1.1.1
Provides various classes that assist with ASP.NET Core 2 development.
5 versions - Latest release: over 5 years ago - 5.36 thousand downloads total - 0 stars on GitHub - 1 maintainer
zgrid 1.0.0.116
asp.net mvc grid extension based on jquery datatables
2 versions - Latest release: over 8 years ago - 2.97 thousand downloads total - 0 stars on GitHub - 1 maintainer
excelmvc.net 2.1.0
Writing Excel applications in .NET using MVC pattern & high performance user defined fuctions, in...
12 versions - Latest release: 6 days ago - 1.98 thousand downloads total - 0 stars on GitHub - 1 maintainer
peterpalmer.mvcextracontrols 1.0.0
Helpfull extensions to System.Web.Mvc.HtmlHelper. ListEditorFor-extension creates an editor to ad...
1 version - Latest release: over 124 years ago - 0 stars on GitHub
identitymanagement.mvc 1.0.2
Asp.Net Identity management dashboard to help you manage user accounts and roles
1 version - Latest release: about 7 years ago - 4.13 thousand downloads total - 0 stars on GitHub - 1 maintainer
kingdom.aspnet.mvc.castle.windsor 1.2.3
Castle Windsor boostrap for use with Microsoft ASP.NET MVC.
9 versions - Latest release: over 7 years ago - 1 dependent package - 1 dependent repositories - 9.04 thousand downloads total - 0 stars on GitHub - 1 maintainer
meadcoscriptxaspnetmvc 2.4.2
The package provides helpers to define the print settings such as headers and footers, margins, p...
10 versions - Latest release: almost 5 years ago - 8.22 thousand downloads total - 0 stars on GitHub - 1 maintainer
awstools 1.0.18
AWS DynamoDB client wrapper with generics. Compatible with AWS Lambda. Compatible with MVC.
19 versions - Latest release: about 5 years ago - 1 dependent package - 1 dependent repositories - 26.1 thousand downloads total - 0 stars on GitHub - 1 maintainer
base64image 1.0.1
easily add images as a base64 encoded string to MVC Razor views
2 versions - Latest release: over 7 years ago - 2.36 thousand downloads total - 0 stars on GitHub - 1 maintainer
ornament.uow.ef 0.1.5
Package Description
3 versions - Latest release: over 6 years ago - 3.06 thousand downloads total - 0 stars on GitHub - 1 maintainer
pi.nlog.web.aspnetcore 2.0.0
Useful extensions for NLog.Web.AspNetCore
2 versions - Latest release: over 5 years ago - 2.76 thousand downloads total - 0 stars on GitHub - 1 maintainer
simplemodelwrapper 1.0.0
An ASP.NET Core Model wrapper to take all the hard lifting away.
1 version - Latest release: over 4 years ago - 532 downloads total - 0 stars on GitHub - 1 maintainer
injectrequiredattribute.fody 0.1.1
A Fody add-in to inject the MVC Required Attribute.
3 versions - Latest release: over 7 years ago - 5.46 thousand downloads total - 0 stars on GitHub - 1 maintainer
fstemplate.mvc 1.1.0
FSTemplate implementation for ASP.NET MVC
3 versions - Latest release: almost 7 years ago - 2.83 thousand downloads total - 0 stars on GitHub - 1 maintainer
hbs.localizedvalidationattributes.kentico.mvc 12.29.1
Localized variations of the default DataAnnotation Attributes that allow your ErrorMessage to con...
2 versions - Latest release: about 4 years ago - 1 dependent repositories - 3.23 thousand downloads total - 0 stars on GitHub - 1 maintainer
dependancyinjectionassistant 1.0.0
Use this version: https://www.nuget.org/packages/DIAssistant/
1 version - Latest release: over 124 years ago - 0 stars on GitLab.com
codeconverters.mvc 0.0.36
An opinionated set of coding conventions for ASP.Net development
22 versions - Latest release: almost 8 years ago - 27.2 thousand downloads total - 0 stars on GitHub - 1 maintainer
cleanarch.templates 1.0.0
Templates for creating ASP.NET Core Web APIs, MVC, and Blazor web applications.
1 version - Latest release: 3 months ago - 740 downloads total - 0 stars on GitHub - 1 maintainer
aspnetmvcurlhelper 1.0.0
ASP.NET MVC Build Url Route Helper
2 versions - Latest release: about 8 years ago - 7.16 thousand downloads total - 0 stars on GitHub - 1 maintainer
instancerframework.mvc 1.0.1
The InstancerFramework serves to create instances of domain objects through the ASP.NET MVC FormC...
2 versions - Latest release: over 7 years ago - 2.56 thousand downloads total - 0 stars on GitHub - 1 maintainer
knockout.bindingconventions.duocode 0.2.10
A DuoCode Binding for the Knockout.BindingConventions library
3 versions - Latest release: about 9 years ago - 3.81 thousand downloads total - 0 stars on GitHub - 1 maintainer
authorization.kentico.mvc 13.0.0
Authorization attribute that integrates with Kentico user permissions, including module permissio...
2 versions - Latest release: over 3 years ago - 1.17 thousand downloads total - 0 stars on GitHub - 1 maintainer
epiglue 0.5.1
Unobtrusive EPiServer 7 page editor support for ASP.NET MVC applications, friendly URLs and exten...
3 versions - Latest release: almost 11 years ago - 1 dependent package - 1 dependent repositories - 4.92 thousand downloads total - 0 stars on GitHub - 1 maintainer
hbs.statictextcontainerizedwidget.kentico.mvc 12.29.3
Containerized Static Text Widget for entering static text into a page builder section.
3 versions - Latest release: about 4 years ago - 1 dependent repositories - 3.94 thousand downloads total - 0 stars on GitHub - 1 maintainer
kb-leca 1.0.0
Logging, error catching and authentication solution for Asp Net Mvc projects.
1 version - Latest release: about 2 years ago - 243 downloads total - 0 stars on GitHub - 1 maintainer
migazo 1.0.2
Project for MVC helpers and extensions
3 versions - Latest release: almost 7 years ago - 3.64 thousand downloads total - 0 stars on GitHub - 1 maintainer
basebindingmodel 1.1.0
BaseBindingModel is a library that deals with the generic validation and data processing while do...
1 version - Latest release: over 6 years ago - 1.2 thousand downloads total - 0 stars on GitHub - 1 maintainer
lucy 1.0.14158.132
Extension for NancyFx
10 versions - Latest release: almost 10 years ago - 11.6 thousand downloads total - 0 stars on GitHub - 1 maintainer
ssw.healthcheck.sqlverify 1.8.2
SSW Health Check extension for Sql Verify framework. To contribute visit https://github.com/SSWCo...
8 versions - Latest release: almost 9 years ago - 14.9 thousand downloads total - 0 stars on GitHub - 1 maintainer
Top 9.6% on nuget.org
taghelpers 1.0.0
TagHelpers
28 versions - Latest release: over 124 years ago - 2 dependent packages - 0 stars on GitHub
mvctricks.roundtripmodelbinding 2.0.0
MVC Modelstate persistance. Persists modelstate between roundtrips, and thereby eliminating the n...
5 versions - Latest release: about 11 years ago - 7.08 thousand downloads total - 0 stars on GitHub - 1 maintainer
microlib.breadcrumb.core 1.9.1.1
Microlib.BreadCrumb.Core Creates custom bread crumb definitions, based on Twitter Bootstrap 3.x a...
1 version - Latest release: over 4 years ago - 510 downloads total - 0 stars on GitHub - 1 maintainer
client-mvc 0.9.0
A lightweight client MVC framework for building small Single Page Applications in Javascript. Bas...
8 versions - Latest release: almost 9 years ago - 9.32 thousand downloads total - 0 stars on GitHub - 1 maintainer
ujmw.dynamiccontroller 2.2.1
A dynamic Service-Facade (Controller) for ASP core WebApi, using the 'Unified JSON Message Wrappe...
15 versions - Latest release: 1 day ago - 1.68 thousand downloads total - 0 stars on GitHub - 1 maintainer
htmltable 1.0.0
HtmlTable for MVC
1 version - Latest release: over 7 years ago - 2.28 thousand downloads total - 0 stars on GitHub - 1 maintainer
mpsoft.aspnet.grpc.mvcapigenerator.abstractions 1.0.0
MpSoft.AspNet.Grpc.MvcApiGenerator is source-generating library generating ASP.NET MVC API contro...
1 version - Latest release: over 3 years ago - 435 downloads total - 0 stars on GitHub - 1 maintainer
seventyeightdigital.plyrmediaplayerwidget.kentico.mvc 1.0.0
Tim Lemke - Seventyeight Digital
1 version - Latest release: over 4 years ago - 546 downloads total - 0 stars on GitHub - 1 maintainer
dnmoft.recaptcha.mvc 1.0.0
ReCAPTCHA MVC lets you embed a CAPTCHA in your web pages in order to protect them against spam an...
2 versions - Latest release: almost 5 years ago - 1 dependent repositories - 1.38 thousand downloads total - 0 stars on GitHub - 1 maintainer
web.routetester.mvc.3.0 1.0.2
Small library to help unit testing ASP MVC 3.0 routes. Uses latest Moq library version.
2 versions - Latest release: about 10 years ago - 1.33 thousand downloads total - 0 stars on GitHub - 1 maintainer
ssw.healthcheck 1.0.4
This package is obsolete. Please use SSW.HealthCheck.Mvc5
2 versions - Latest release: over 124 years ago - 1 dependent package - 0 stars on GitHub
sheleski.delimitedfile.mvccore 0.1.0
Helpers for Sheleski.DelimitedFile for ASP.NET MVCCore.
4 versions - Latest release: over 2 years ago - 1.03 thousand downloads total - 0 stars on GitHub - 1 maintainer
caseiro.mvc.pagedlist 1.0.2
A paged list helper for ASP.NET MVC with filter and order functionalities
3 versions - Latest release: over 10 years ago - 1 dependent repositories - 7.32 thousand downloads total - 0 stars on GitHub - 1 maintainer
seventyeightdigital.placeholderimagewidget.kentico.mvc 1.0.0
Adds placeholder image generation capabilities for MVC. Includes Placeholder Image Widget that in...
1 version - Latest release: over 4 years ago - 469 downloads total - 0 stars on GitHub - 1 maintainer
streamresult 1.0.0
Easily write a stream without buffering
4 versions - Latest release: over 8 years ago - 4.18 thousand downloads total - 0 stars on GitHub - 1 maintainer
Top 9.3% on nuget.org
ssw.sqlverify.core 1.1.0
SSW SqlVerify Core provides a simple tool that performs database check whether it has been manual...
2 versions - Latest release: about 10 years ago - 4 dependent packages - 2 dependent repositories - 21 thousand downloads total - 0 stars on GitHub - 1 maintainer
mpsoft.aspnet.grpc.mvcapi.compilecache 1.0.0
MpSoft.AspNet.Grpc.MvcApi is library generating ASP.NET MVC API controllers for the gRPC services.
1 version - Latest release: over 3 years ago - 453 downloads total - 0 stars on GitHub - 1 maintainer
fluentmigrator-mvc-helper 1.0.1
This is a helper console which will help with the FluentMigrator, step by step instructions and o...
1 version - Latest release: over 8 years ago - 2.15 thousand downloads total - 0 stars on GitHub - 1 maintainer
authorizenet.helpers 0.9.4
Html Helpers for Authorize .NET
2 versions - Latest release: about 9 years ago - 1 dependent repositories - 127 thousand downloads total - 0 stars on GitHub - 1 maintainer
mvcextracontrols.listeditor 1.0.3
Helpfull extensions to System.Web.Mvc.HtmlHelper. Method ListEditorFor creates an editor to add, ...
4 versions - Latest release: over 6 years ago - 6.37 thousand downloads total - 0 stars on GitHub - 1 maintainer
mpsoft.aspnet.grpc.mvcapigenerator.runtime 1.0.1
MpSoft.AspNet.Grpc.MvcApiGenerator is source-generating library generating ASP.NET MVC API contro...
2 versions - Latest release: about 3 years ago - 766 downloads total - 0 stars on GitHub - 1 maintainer