Ecosyste.ms: Packages

An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.

nuget.org "SAML2" keyword

passingwind.abp.identityclient.aspnetcore 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.22 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.domain.shared 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.85 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.application.contracts 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.44 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.httpapi.client 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.09 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.application 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.03 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.mongodb 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.11 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.httpapi 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.08 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.entityframeworkcore 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.05 thousand downloads total - 8 stars on GitHub - 1 maintainer
passingwind.abp.identityclient.domain 1.1.1
an abp module that provider dynamic identity provider, support oidc, saml2
8 versions - Latest release: 2 days ago - 2.46 thousand downloads total - 8 stars on GitHub - 1 maintainer
dk.nita.saml20.ext.sessionstore.sqlserver 3.0.4
This is a Sql Server implementation of the ISessionStoreProvider used in OIOSAML.NET (dk.nita.sam...
21 versions - Latest release: 12 months ago - 14.1 thousand downloads total - 1 maintainer
Top 4.2% on nuget.org
dk.nita.saml20 3.0.4
OIOSAML.NET is a. Net-based SAML 2.0 toolkit with a reference implementation that complies with t...
30 versions - Latest release: 12 months ago - 2 dependent packages - 10 dependent repositories - 147 thousand downloads total - 1 maintainer
oldmusicbox.epuap.client 1.24.3
OldMusicBox.ePUAP.Client. Independent ePUAP Client implementation.
11 versions - Latest release: 2 months ago - 3.95 thousand downloads total - 12 stars on GitHub - 1 maintainer
dk.nita.saml20.ext.appfabricsessioncache 1.0.0
This is an app fabric session provider implementation of the ISessions interface used in OIOSAML....
9 versions - Latest release: over 124 years ago
samlidp.owin 1.0.0
Saml2 IdP Owin Middleware
1 version - Latest release: about 8 years ago - 1.49 thousand downloads total - 4 stars on GitHub - 1 maintainer
Top 7.6% on nuget.org
itfoxtec.saml2 1.2.4
Maintenance of this component is discontinued. Please use the "ITfoxtec Identity Saml2" component...
9 versions - Latest release: about 8 years ago - 1 dependent package - 1 dependent repositories - 85.7 thousand downloads total - 1 maintainer
rsk.identityserver4.saml 5.0.0
SAML 2.0 (SAML2P) support for Duende IdentityServer, providing SAML 2.0 Identity Provider and Ser...
84 versions - Latest release: over 3 years ago - 471 thousand downloads total - 1 maintainer
Top 7.2% on nuget.org
owin.security.saml 1.0.0
Owin middleware to implement the SAML2 Protocol as a Service Provider
6 versions - Latest release: over 6 years ago - 2 dependent repositories - 141 thousand downloads total - 113 stars on GitHub - 1 maintainer
Top 8.4% on nuget.org
kentor.authservices 0.23.0
SAML2 Protocol library for ASP.NET. Don't reference this directly, use one of the API modules: Su...
32 versions - Latest release: over 6 years ago - 1.09 million downloads total - 926 stars on GitHub - 2 maintainers
test.license2 0.2.0
A SAML2 Service Provider for ASP.NET. Built to mimic the WSFederationAuthenticationModule in .NET...
1 version - Latest release: over 124 years ago
scott.munro.saml2.core 1.2.0
Based on http://www.nuget.org/packages/SAML2/, this removes dependencies on System.Web. Packages ...
2 versions - Latest release: over 2 years ago - 1.12 thousand downloads total - 0 stars on GitHub - 1 maintainer
Top 5.6% on nuget.org
kentor.authservices.owin 0.23.0
A SAML2 Owin middleware, compatible with ASP.NET Identity for external logins.
28 versions - Latest release: over 6 years ago - 5 dependent repositories - 469 thousand downloads total - 926 stars on GitHub - 2 maintainers
dk.nita.saml20.ext.audit.log4net 3.0.4
This is an log4net implementation of the audit logging used in OIOSAML.NET (dk.nita.saml20)
23 versions - Latest release: 12 months ago - 1 dependent repositories - 60.7 thousand downloads total - 1 maintainer
torch.id4.saml2.aspnetcore2 2.4.2
ASP.NET Core authentication handler for the SAML2 protocol, compatible with Asp.Net Core 2.X
3 versions - Latest release: about 4 years ago - 2.06 thousand downloads total - 926 stars on GitHub - 1 maintainer
quantumit.kentor.authservices 0.6.0
Package Description
2 versions - Latest release: almost 6 years ago - 1 dependent package - 2.26 thousand downloads total - 926 stars on GitHub - 1 maintainer
Top 5.7% on nuget.org
kentor.authservices.mvc 0.23.0
A SAML2 Service Provider for ASP.NET MVC. Install in project and add sections to web.config. No c...
29 versions - Latest release: over 6 years ago - 4 dependent repositories - 334 thousand downloads total - 926 stars on GitHub - 2 maintainers
Top 3.7% on nuget.org
kentor.authservices.httpmodule 0.23.0
A SAML2 Http Module for ASP.NET. Install in project and add sections to web.config. No coding req...
17 versions - Latest release: over 6 years ago - 1 dependent package - 4 dependent repositories - 426 thousand downloads total - 926 stars on GitHub - 2 maintainers
saml2.dotnet35.core 0.4.1
Based on https://www.nuget.org/packages/SAML2.Core/ changed the dotnet version to 3.5 for use in ...
5 versions - Latest release: about 8 years ago - 6.77 thousand downloads total - 1 stars on GitHub - 1 maintainer
Top 6.7% on nuget.org
saml2.core 1.0.0
Based on http://www.nuget.org/packages/SAML2/, this removes dependencies on System.Web. Packages ...
6 versions - Latest release: over 6 years ago - 3 dependent repositories - 269 thousand downloads total - 113 stars on GitHub - 1 maintainer
itfoxtec.saml2.mvc 1.2.4
Maintenance of this component is discontinued. Please use the "ITfoxtec Identity Saml2 MVC" compo...
9 versions - Latest release: about 8 years ago - 1 dependent repositories - 46.1 thousand downloads total - 1 maintainer
Top 8.5% on nuget.org
test.license 0.2.0
A SAML2 Service Provider for ASP.NET. Built to mimic the WSFederationAuthenticationModule in .NET...
1 version - Latest release: over 124 years ago - 859 stars on GitHub
totaldefense.saml2 2.3.3
SAML2 protocol support. Do not use directly, use the high level package for your platform.
4 versions - Latest release: about 4 years ago - 1 dependent package - 2.54 thousand downloads total - 926 stars on GitHub - 1 maintainer
quantumit.kentor.authservices.aspnetcore 0.6.0
Package Description
6 versions - Latest release: almost 6 years ago - 5.93 thousand downloads total - 926 stars on GitHub - 1 maintainer
oldmusicbox.saml2 0.66.0.26423
OldMusicBox.Saml2. Independent SAML2 implementation.
2 versions - Latest release: about 4 years ago - 1 dependent package - 1 dependent repositories - 1.36 thousand downloads total - 2 stars on GitHub - 1 maintainer
sustainsys.saml2 2.9.2
SAML2 protocol support. Do not use directly, use the high level package for your platform.
19 versions - Latest release: 8 months ago - 6.76 million downloads total - 926 stars on GitHub - 1 maintainer
torch.id4.saml2 2.4.2
SAML2 protocol support. Do not use directly, use the high level package for your platform.
3 versions - Latest release: about 4 years ago - 1 dependent package - 2.53 thousand downloads total - 926 stars on GitHub - 1 maintainer
totaldefense.saml2.aspnetcore2 2.3.3
Package Description
4 versions - Latest release: about 4 years ago - 1.96 thousand downloads total - 926 stars on GitHub - 1 maintainer
genex.sustainsys.saml2 1.0.0
SAML2 protocol support. Do not use directly, use the high level package for your platform.
1 version - Latest release: over 124 years ago
Top 6.7% on nuget.org
saml2.authentication.core 3.0.1
SAML 2.0 authentication middleware for ASP.NET Core
11 versions - Latest release: almost 3 years ago - 1 dependent repositories - 79 thousand downloads total - 89 stars on GitHub - 1 maintainer
scott.munro.owin.security.saml 1.2.0
Owin middleware to implement the SAML2 Protocol as a Service Provider
3 versions - Latest release: over 2 years ago - 1.32 thousand downloads total - 0 stars on GitHub - 1 maintainer
oldmusicbox.eih.client 0.70.7864.23686
OldMusicBox.EIH.Client. Independent Węzeł Krajowy implementation.
3 versions - Latest release: almost 3 years ago - 1.27 thousand downloads total - 4 stars on GitHub - 1 maintainer
identity.saml2 1.0.1
The Identity Saml2 package adds SAML-P support for both Identity Provider (IdP) and Relying Party...
2 versions - Latest release: over 2 years ago - 3.13 thousand downloads total - 1 maintainer
lofcz.forks.itfoxtec.identity.saml2 4.8.7-test
The ITfoxtec Identity Saml2 package adds SAML-P support for both Identity Provider (IdP) and Rely...
1 version - Latest release: 11 months ago
rsk.saml.identityserver4.entityframework 4.0.1
EntityFramework Core support for Rsk.Saml.IdentityServer4
4 versions - Latest release: over 1 year ago - 28.4 thousand downloads total - 1 maintainer
passingwind.authentication.saml2 0.1.0
ASP.NET Core authentication handler for the SAML2 protocol
1 version - Latest release: 9 months ago - 423 downloads total - 1 stars on GitHub - 1 maintainer
passingwind.abp.identityclientmanagement.mongodb 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: 7 months ago - 980 downloads total - 7 stars on GitHub - 1 maintainer
Top 9.5% on nuget.org
rsk.saml.identityserver4 5.3.1
SAML 2.0 (SAML2P) support for IdentityServer4, providing SAML 2.0 Identity Provider and Service P...
10 versions - Latest release: over 1 year ago - 94.2 thousand downloads total - 1 maintainer
passingwind.abp.identityclientmanagement.application.contracts 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
lofcz.forks.itfoxtec.identity.saml2.mvccore 4.8.7-test
ASP.NET MVC Core is supported by the ITfoxtec Identity SAML2 MVC Core package which helps to inte...
1 version - Latest release: 11 months ago
uox.saml2.authentication 4.0.5
SAML 2.0 authentication middleware
2 versions - Latest release: 8 months ago - 784 downloads total - 0 stars on GitHub - 1 maintainer
thanasi.auth.core 1.0.1
SAML 2.0 authentication middleware for ASP.NET Core
2 versions - Latest release: about 1 year ago - 1.02 thousand downloads total - 1 maintainer
passingwind.aspnetcore.authentication.saml2 0.3.0
ASP.NET Core authentication handler for the SAML2 protocol
4 versions - Latest release: 4 months ago - 2.09 thousand downloads total - 1 stars on GitHub - 1 maintainer
passingwind.abp.identityclientmanagement.httpapi.client 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
passingwind.abp.identityclientmanagement.domain 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
passingwind.abp.identityclientmanagement.aspnetcore 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
fquintella-saml2.authentication.core 4.0.3
SAML 2.0 authentication middleware for ASP.NET Core
1 version - Latest release: over 124 years ago - 0 stars on GitHub
passingwind.abp.identityclientmanagement.httpapi 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
sustainsys.saml2.owin 2.9.2
A SAML2 Owin middleware, compatible with ASP.NET Identity for external logins.
18 versions - Latest release: 8 months ago - 1.09 million downloads total - 926 stars on GitHub - 1 maintainer
passingwind.abp.identityclientmanagement.entityframeworkcore 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
passingwind.abp.identityclientmanagement.domain.shared 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
sustainsys.saml2.mvc 2.9.2
A SAML2 Service Provider for ASP.NET MVC. Install in project and add sections to web.config. No c...
18 versions - Latest release: 8 months ago - 393 thousand downloads total - 926 stars on GitHub - 1 maintainer
passingwind.abp.identityclientmanagement.application 0.3.1
an abp module that provider dynamic identity provider, support oidc, saml2
6 versions - Latest release: over 124 years ago - 3 stars on GitHub
sustainsys.saml2.httpmodule 2.9.2
A SAML2 Http Module for ASP.NET. Install in project and add sections to web.config. No coding req...
18 versions - Latest release: 8 months ago - 629 thousand downloads total - 926 stars on GitHub - 1 maintainer
sustainsys.saml2.aspnetcore2 2.9.2
ASP.NET Core authentication handler for the SAML2 protocol, compatible with Asp.Net Core 2.X and 3.X
20 versions - Latest release: 8 months ago - 4.33 million downloads total - 926 stars on GitHub - 1 maintainer
itfoxtec.identity.saml2.mvc 4.10.8
ASP.NET MVC is supported by the ITfoxtec Identity SAML2 MVC package which helps to integrate the ...
67 versions - Latest release: 4 months ago - 359 thousand downloads total - 1 maintainer
itfoxtec.identity.saml2.mvccore 4.10.8
ASP.NET MVC Core is supported by the ITfoxtec Identity SAML2 MVC Core package which helps to inte...
68 versions - Latest release: 4 months ago - 2.18 million downloads total - 1 maintainer
itfoxtec.identity.saml2 4.10.8
The ITfoxtec Identity Saml2 package adds SAML-P support for both Identity Provider (IdP) and Rely...
67 versions - Latest release: 4 months ago - 3.27 million downloads total - 1 maintainer
rsk.saml.openiddict 9.1.0
SAML 2.0 (SAML2P) support for Rsk.Saml.OpenIddict, providing SAML 2.0 Identity Provider and Servi...
5 versions - Latest release: about 2 months ago - 708 downloads total - 1 maintainer
rsk.saml.duendeidentityserver 9.1.0
SAML 2.0 (SAML2P) support for Duende IdentityServer, providing SAML 2.0 Identity Provider and Ser...
30 versions - Latest release: about 2 months ago - 216 thousand downloads total - 1 maintainer
rsk.saml.duendeidentityserver.entityframework 9.1.0
EntityFramework Core support for Rsk.Saml.DuendeIdentityServer
17 versions - Latest release: about 2 months ago - 90 thousand downloads total - 1 maintainer
rsk.saml 9.1.0
SAML 2.0 (SAML2P) service provider authentication handler. To purchase a license or get a demo li...
55 versions - Latest release: about 2 months ago - 715 thousand downloads total - 1 maintainer
rsk.saml.openiddict.aspnetcore.identity 9.1.0
SAML 2.0 (SAML2P) support for Rsk.Saml.OpenIddict, providing SAML 2.0 Identity Provider and Servi...
5 versions - Latest release: about 2 months ago - 541 downloads total - 1 maintainer
rsk.saml.openiddict.quartz 9.1.0
SAML 2.0 (SAML2P) support for Rsk.Saml.OpenIddict, providing SAML 2.0 Identity Provider and Servi...
5 versions - Latest release: about 2 months ago - 520 downloads total - 1 maintainer
rsk.saml.entityframework 9.1.0
EntityFramework Core support for Rsk.Saml.
15 versions - Latest release: about 2 months ago - 119 thousand downloads total - 1 maintainer
rsk.saml.openiddict.entityframeworkcore 9.1.0
EntityFramework Core support for Rsk.Saml.OpenIddict
5 versions - Latest release: about 2 months ago - 520 downloads total - 1 maintainer
rsk.saml.identityprovider.storage.entityframework 9.1.0
EntityFramework Core support for Rsk.Saml.IdentityProvider. Requires the addition of Rsk.Saml.Due...
16 versions - Latest release: about 2 months ago - 149 thousand downloads total - 1 maintainer
rsk.saml.identityprovider 9.1.0
SAML 2.0 (SAML2P) identity provider functionality. Requires the addition of Rsk.Saml.DuendeIdenti...
36 versions - Latest release: about 2 months ago - 404 thousand downloads total - 1 maintainer