Ecosyste.ms: Packages

An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.

nuget.org "aws-sdk-v3" keyword

Top 7.4% on nuget.org
awssdk.core 3.7.303
The Amazon Web Services SDK for .NET - Core Runtime
1,063 versions - Latest release: about 2 months ago - 792 million downloads total - 2,006 stars on GitHub - 1 maintainer
Top 7.4% on nuget.org
awssdk.s3 3.7.307
Amazon Simple Storage Service (Amazon S3), provides developers and IT teams with secure, durable,...
1,075 versions - Latest release: about 2 months ago - 245 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.sqs 3.7.301
Amazon Simple Queue Service (SQS) is a fast, reliable, scalable, fully managed message queuing se...
971 versions - Latest release: 3 days ago - 116 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.securitytoken 3.7.300
The AWS Security Token Service (AWS STS) enables you to provide trusted users with temporary cred...
978 versions - Latest release: 6 months ago - 114 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.extensions.netcore.setup 3.7.300
Extensions for the AWS SDK for .NET to integrate with .NET Core configuration and dependency inje...
23 versions - Latest release: 6 months ago - 102 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.dynamodbv2 3.7.303
Amazon DynamoDB is a fast and flexible NoSQL database service for all applications that need cons...
1,007 versions - Latest release: 9 days ago - 92.7 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.simplesystemsmanagement 3.7.304
Amazon EC2 Simple Systems Manager (SSM) enables you to manage a number of administrative and conf...
1,036 versions - Latest release: 17 days ago - 80.6 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.simplenotificationservice 3.7.301
Amazon Simple Notification Service (Amazon SNS) is a fast, flexible, fully managed push messaging...
953 versions - Latest release: 3 months ago - 80.1 million downloads total - 2,004 stars on GitHub - 1 maintainer
awssdk.secretsmanager 3.7.302
AWS Secrets Manager enables you to easily create and manage the secrets that you use in your cust...
922 versions - Latest release: 5 months ago - 72.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.cloudwatchlogs 3.7.305
Amazon CloudWatch is a monitoring service for AWS cloud resources and the applications you run on...
980 versions - Latest release: about 2 months ago - 46 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.lambda 3.7.305
AWS Lambda is a compute service that runs your code in response to events and automatically manag...
1,011 versions - Latest release: about 1 month ago - 44.9 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.simpleemail 3.7.300
Amazon SES is an outbound-only email-sending service that provides an easy, cost-effective way fo...
966 versions - Latest release: 6 months ago - 35.2 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.keymanagementservice 3.7.302
AWS Key Management Service (KMS) is a managed service that makes it easy for you to create and co...
972 versions - Latest release: 29 days ago - 32.4 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.kinesis 3.7.301
Amazon Kinesis is a fully managed, cloud-based service for real-time processing of large, distrib...
965 versions - Latest release: 6 months ago - 26.5 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.cloudwatch 3.7.304
Amazon CloudWatch is a monitoring service for AWS cloud resources and the applications you run on...
972 versions - Latest release: 30 days ago - 26.2 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.cognitoidentityprovider 3.7.305
You can create a user pool in Amazon Cognito Identity to manage directories and users. You can au...
970 versions - Latest release: 3 days ago - 25.5 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.extensions.configuration.systemsmanager 6.1.1
.NET Configuration Extensions for AWS Systems Manager
20 versions - Latest release: 22 days ago - 25.2 million downloads total - 171 stars on GitHub - 1 maintainer
awssdk.ec2 3.7.327
Amazon Elastic Compute Cloud (Amazon EC2) is a web service that provides resizable compute capaci...
1,194 versions - Latest release: 3 days ago - 19.9 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.identitymanagement 3.7.301
AWS Identity and Access Management (IAM) enables you to securely control access to AWS services a...
984 versions - Latest release: 30 days ago - 19.4 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.cognitoidentity 3.7.300
Amazon Cognito is a service that makes it easy to save user data, such as app preferences or game...
964 versions - Latest release: 6 months ago - 19 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.cloudformation 3.7.307
AWS CloudFormation gives developers and systems administrators an easy way to create and manage a...
993 versions - Latest release: 29 days ago - 18.7 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.kinesisfirehose 3.7.304
Amazon Kinesis Firehose is a fully managed service for ingesting data streams directly into AWS d...
962 versions - Latest release: 3 months ago - 16.6 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.stepfunctions 3.7.302
AWS Step Functions is a web service that enables you to coordinate a network of computing resourc...
896 versions - Latest release: 6 months ago - 15.4 million downloads total - 1,999 stars on GitHub - 1 maintainer
awssdk.cloudfront 3.7.302
Amazon CloudFront is a content delivery web service. It integrates with other Amazon Web Services...
988 versions - Latest release: 30 days ago - 14.6 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.rds 3.7.312
Amazon Relational Database Service (Amazon RDS) is a web service that makes it easy to set up, op...
1,063 versions - Latest release: 15 days ago - 13.6 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.ecs 3.7.305
Amazon EC2 Container Service is a highly scalable, high performance container management service ...
1,014 versions - Latest release: 4 months ago - 13.5 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.xray 3.7.300
AWS X-Ray helps developers analyze and debug distributed applications. With X-Ray, you can unders...
931 versions - Latest release: 6 months ago - 13.3 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.sso 3.7.300
This is an initial release of AWS Single Sign-On (SSO) end-user access. This release adds support...
745 versions - Latest release: 6 months ago - 11.3 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.ssooidc 3.7.301
This is an initial release of AWS Single Sign-On OAuth device code authorization service.
746 versions - Latest release: 6 months ago - 11.1 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.eventbridge 3.7.302
Amazon EventBridge is a serverless event bus service that makes it easy to connect your applicati...
802 versions - Latest release: 4 months ago - 10.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.appconfigdata 3.7.301
AWS AppConfig Data is a new service that allows you to retrieve configuration deployed by AWS App...
437 versions - Latest release: 4 months ago - 10.4 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.athena 3.7.303
This release adds support for Amazon Athena. Amazon Athena is an interactive query service that m...
918 versions - Latest release: 4 months ago - 10.2 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.ecr 3.7.302
Amazon EC2 Container Registry (Amazon ECR) is a managed AWS Docker registry service. Customers ca...
963 versions - Latest release: 3 days ago - 9.85 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.autoscaling 3.7.302
Auto Scaling helps you maintain application availability and allows you to scale your capacity up...
981 versions - Latest release: 3 months ago - 9.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.elasticache 3.7.302
ElastiCache is a web service that makes it easy to deploy, operate, and scale an in-memory cache ...
973 versions - Latest release: about 1 month ago - 9.38 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.apigateway 3.7.300
Amazon API Gateway helps developers deliver robust, secure and scalable mobile and web applicatio...
983 versions - Latest release: 6 months ago - 9.21 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.route53 3.7.302
Amazon Route 53 is a highly available and scalable cloud Domain Name System (DNS) web service.
985 versions - Latest release: 4 months ago - 9.06 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.certificatemanager 3.7.300
AWS Certificate Manager (ACM) is an AWS service that makes it easier for you to deploy secure SSL...
962 versions - Latest release: 6 months ago - 8.52 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.elasticloadbalancingv2 3.7.302
Elastic Load Balancing automatically distributes incoming application traffic across multiple com...
958 versions - Latest release: 3 months ago - 8.3 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.cloudwatchevents 3.7.300
Amazon CloudWatch Events helps you to respond to state changes in your AWS resources. When your r...
955 versions - Latest release: 6 months ago - 8.1 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.secretsmanager.caching 1.0.6
The AWS Secrets Manager .NET caching client enables in-process caching of secrets for C# applicat...
7 versions - Latest release: 11 months ago - 8.07 million downloads total - 52 stars on GitHub - 1 maintainer
awssdk.appconfig 3.7.301
Introducing AWS AppConfig, a new service that enables customers to quickly deploy validated confi...
746 versions - Latest release: 2 months ago - 7.55 million downloads total - 2,007 stars on GitHub - 1 maintainer
amazon.extensions.cognitoauthentication 2.5.4
An extension library to assist in the Amazon Cognito User Pools authentication process.
25 versions - Latest release: 8 days ago - 7.35 million downloads total - 102 stars on GitHub - 1 maintainer
awssdk.elasticmapreduce 3.7.304
Amazon Elastic MapReduce (Amazon EMR) is a web service that makes it easy to quickly and cost-eff...
970 versions - Latest release: 3 months ago - 7.07 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.applicationautoscaling 3.7.301
Application Auto Scaling is a general purpose Auto Scaling service for supported elastic AWS reso...
964 versions - Latest release: 5 months ago - 7.01 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.cloudtrail 3.7.304
AWS CloudTrail is a web service that records AWS API calls for your account and delivers log file...
967 versions - Latest release: 2 months ago - 6.97 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.glue 3.7.310
AWS Glue is a fully managed extract, transform, and load (ETL) service that makes it easy for cus...
954 versions - Latest release: 22 days ago - 6.88 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.translate 3.7.300
Public preview release of Amazon Translate and the Amazon Translate Developer Guide. For more inf...
909 versions - Latest release: 6 months ago - 6.84 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.elasticloadbalancing 3.7.300
Elastic Load Balancing automatically distributes incoming application traffic across multiple com...
928 versions - Latest release: 6 months ago - 6.82 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.elasticbeanstalk 3.7.300
AWS Elastic Beanstalk is an easy-to-use service for deploying and scaling web applications and se...
969 versions - Latest release: 6 months ago - 6.8 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.redshift 3.7.305
Amazon Redshift is a fast, fully managed, petabyte-scale data warehouse solution that makes it si...
976 versions - Latest release: 29 days ago - 6.53 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.elasticfilesystem 3.7.302
Amazon Elastic File System (Amazon EFS) is a file storage service for Amazon Elastic Compute Clou...
963 versions - Latest release: 6 months ago - 6.38 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.apigatewayv2 3.7.300
This is the initial SDK release for the Amazon API Gateway v2 APIs. This SDK will allow you to ma...
864 versions - Latest release: 6 months ago - 6.36 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.configservice 3.7.302
AWS Config is a fully managed service that provides you with an AWS resource inventory, configura...
1,001 versions - Latest release: 4 months ago - 6.29 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.s3control 3.7.305
Add support for new S3 Block Public Access account-level APIs. The Block Public Access settings a...
885 versions - Latest release: 4 months ago - 6.27 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.workspaces 3.7.303
Amazon WorkSpaces is a managed desktop computing service in the cloud.
968 versions - Latest release: 23 days ago - 6.27 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.sagemaker 3.7.320
Amazon SageMaker is a fully-managed service that enables data scientists and developers to quickl...
976 versions - Latest release: 11 days ago - 6.23 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.wafv2 3.7.304
This release introduces new set of APIs (wafv2) for AWS WAF. Major changes include single set of ...
745 versions - Latest release: 30 days ago - 6.2 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.transfer 3.7.306
AWS Transfer for SFTP is a fully managed service that enables transfer of secure data over the in...
886 versions - Latest release: 19 days ago - 6.15 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.databasemigrationservice 3.7.301
AWS Database Migration Service (AWS DMS) can migrate your data to and from most widely used comme...
964 versions - Latest release: 6 months ago - 6.09 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.organizations 3.7.302
AWS Organizations is a web service that enables you to consolidate your multiple AWS accounts int...
938 versions - Latest release: 2 months ago - 6.06 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.elasticsearch 3.7.302
Use the Amazon Elasticsearch configuration API to create, configure, and manage Elasticsearch dom...
961 versions - Latest release: 3 months ago - 6.03 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.marketplaceentitlementservice 3.7.301
AWS Marketplace Entitlement Service enables AWS Marketplace sellers to determine the capacity pur...
906 versions - Latest release: 6 months ago - 6 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.transcribeservice 3.7.303
Amazon Transcribe Public Preview Release
920 versions - Latest release: 12 days ago - 5.92 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.storagegateway 3.7.301
The AWS Storage Gateway is a service connecting an on-premises software appliance with cloud-base...
982 versions - Latest release: 4 months ago - 5.92 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.mq 3.7.300
This is the initial SDK release for Amazon MQ. Amazon MQ is a managed message broker service for ...
907 versions - Latest release: 6 months ago - 5.91 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.route53domains 3.7.301
Amazon Route 53 is a highly available and scalable cloud Domain Name System (DNS) web service.
961 versions - Latest release: 3 months ago - 5.79 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.inspector 3.7.300
Amazon Inspector identifies security issues in your application deployments.
931 versions - Latest release: 6 months ago - 5.76 million downloads total - 1,999 stars on GitHub - 1 maintainer
awssdk.kafka 3.7.302
Amazon Managed Streaming for Kafka (Amazon MSK). Amazon MSK is a service that you can use to easi...
879 versions - Latest release: about 2 months ago - 5.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.shield 3.7.300
AWS Shield protects web applications from large and sophisticated DDoS attacks at Layer 3, 4 and ...
934 versions - Latest release: 6 months ago - 5.69 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.guardduty 3.7.306
Enable Amazon GuardDuty to continuously monitor and process AWS data sources to identify threats ...
916 versions - Latest release: 23 days ago - 5.63 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.wafregional 3.7.300
AWS WAF (Web Application Firewall) Regional protects web applications from attack via ALB load ba...
926 versions - Latest release: 6 months ago - 5.49 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.securityhub 3.7.304
AWS Security Hub provides you with a comprehensive view of your security state within AWS and you...
886 versions - Latest release: about 2 months ago - 5.45 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.personalize 3.7.302
Amazon Personalize is a machine learning service that makes it easy for developers to create indi...
814 versions - Latest release: 22 days ago - 5.35 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.accessanalyzer 3.7.303
Introducing AWS IAM Access Analyzer, an IAM feature that makes it easy for AWS customers to ensur...
739 versions - Latest release: about 2 months ago - 5.25 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.backup 3.7.304
AWS Backup is a fully managed backup service that makes it easy to centralize and automate the ba...
866 versions - Latest release: about 2 months ago - 5.18 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.networkfirewall 3.7.300
(New Service) AWS Network Firewall is a managed network layer firewall service that makes it easy...
589 versions - Latest release: 6 months ago - 4.7 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.eks 3.7.305
Amazon Elastic Container Service for Kubernetes (Amazon EKS) is a fully managed service that make...
911 versions - Latest release: about 1 month ago - 4.58 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.simpleemailv2 3.7.303
This is the first release of version 2 of the Amazon SES API. You can use this API to configure y...
750 versions - Latest release: 8 days ago - 4.31 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.appsync 3.7.305
AWS AppSync is an enterprise-level, fully managed GraphQL service with real-time data synchroniza...
916 versions - Latest release: 16 days ago - 4.26 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.macie2 3.7.302
This release introduces a new major version of the Amazon Macie API. You can use this version of ...
677 versions - Latest release: 4 months ago - 4.03 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.account 3.7.300
This release of the Account Management API enables customers to manage the alternate contacts for...
467 versions - Latest release: 6 months ago - 3.89 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.fsx 3.7.304
Amazon FSx provides fully-managed third-party file systems optimized for a variety of enterprise ...
885 versions - Latest release: 2 months ago - 3.46 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.batch 3.7.305
AWS Batch enables developers, scientists, and engineers to easily and efficiently run hundreds of...
936 versions - Latest release: 30 days ago - 3.17 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.apigatewaymanagementapi 3.7.300
This is the initial SDK release for the Amazon API Gateway Management API, which allows you to di...
866 versions - Latest release: 6 months ago - 2.91 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.glacier 3.7.300
Amazon Glacier is a secure, durable, and extremely low-cost storage service for data archiving an...
961 versions - Latest release: 6 months ago - 2.86 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.inspector2 3.7.304
This release adds support for the new Amazon Inspector API. The new Amazon Inspector can automati...
442 versions - Latest release: 8 days ago - 2.85 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.cloudsearchdomain 3.7.300
Amazon CloudSearch Domain encapsulates a collection of data you want to search, the search instan...
952 versions - Latest release: 6 months ago - 2.83 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.pinpoint 3.7.301
Amazon Pinpoint makes it easy to run targeted campaigns to improve user engagement. Pinpoint help...
938 versions - Latest release: about 1 month ago - 2.7 million downloads total - 2,006 stars on GitHub - 1 maintainer
amazon.aspnetcore.identity.cognito 3.0.2
Simplifies using Amazon Cognito as a membership storage solution for building ASP.NET Core web ap...
29 versions - Latest release: 22 days ago - 2.6 million downloads total - 203 stars on GitHub - 1 maintainer
awssdk.textract 3.7.300
Amazon Textract enables you to add document text detection and analysis to your applications. You...
851 versions - Latest release: 6 months ago - 2.53 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.iot 3.7.307
AWS IoT allows you to leverage AWS to build your Internet of Things.
993 versions - Latest release: 2 months ago - 2.19 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.codedeploy 3.7.301
AWS CodeDeploy is a service that automates code deployments. AWS CodeDeploy makes it easier for y...
975 versions - Latest release: 5 months ago - 2.07 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.neptune 3.7.301
Amazon Neptune is a fast, reliable graph database service that makes it easy to build and run app...
905 versions - Latest release: 5 months ago - 2.03 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.rekognition 3.7.302
AWS Rekognition service does image processing and concept recognition, face detection and identif...
948 versions - Latest release: about 1 month ago - 1.94 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.simpledb 3.7.300
Amazon SimpleDB is a highly available, scalable, and flexible non-relational data store that enab...
951 versions - Latest release: 6 months ago - 1.84 million downloads total - 2,007 stars on GitHub - 1 maintainer
awssdk.codecommit 3.7.301
AWS CodeCommit is a fully-managed source control service that makes it easy for companies to host...
957 versions - Latest release: 5 months ago - 1.78 million downloads total - 2,005 stars on GitHub - 1 maintainer
awssdk.iotdata 3.7.300
AWS IoT-Data enables secure, bi-directional communication between Internet-connected things (such...
944 versions - Latest release: 6 months ago - 1.73 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.codepipeline 3.7.304
AWS CodePipeline is a continuous delivery service for fast and reliable application updates.
971 versions - Latest release: 15 days ago - 1.68 million downloads total - 2,006 stars on GitHub - 1 maintainer
awssdk.elastictranscoder 3.7.300
Amazon Elastic Transcoder is media transcoding in the cloud. It is designed to be a highly scalab...
958 versions - Latest release: 6 months ago - 1.64 million downloads total - 2,006 stars on GitHub - 1 maintainer
Related Keywords
Amazon 410 AWS 409 cloud 398 S3 6 configuration 5 Spatial 4 GIS 4 ThinkGeo 4 MapSuite 4 Map 4 Suite 4 .NET 4 DynamoDB 4 secretsmanager 3 manager 3 SimpleSystemsManagement 3 secret 3 secrets 3 caching 3 cache 3 Cognito 3 cognito-user-pool 2 CognitoSync 2 LookoutforVision 1 AmplifyBackend 1 PrometheusService 1 AppIntegrationsService 1 LookoutEquipment 1 AppRunner 1 FIS 1 DevOpsGuru 1 IoTFleetHub 1 LookoutMetrics 1 EMRContainers 1 AuditManager 1 WellArchitected 1 IoTWireless 1 AppRegistry 1 HealthLake 1 ConnectContactLens 1 S3Outposts 1 SageMakerFeatureStoreRuntime 1 LexRuntimeV2 1 GameSparks 1 NeptuneGraph 1 ResilienceHub 1 BedrockRuntime 1 IoTTwinMaker 1 VoiceID 1 Ivschat 1 WorkSpacesWeb 1 ManagedGrafana 1 Drs 1 AmplifyUIBuilder 1 Panorama 1 ConnectWisdomService 1 Route53RecoveryCluster 1 CloudWatchEvidently 1 SnowDeviceManagement 1 ChimeSDKMessaging 1 Route53RecoveryReadiness 1 ChimeSDKIdentity 1 Finspace 1 EMRServerless 1 Route53RecoveryControlConfig 1 ApplicationCostProfiler 1 CloudControlApi 1 FinSpaceData 1 SSMIncidents 1 SSMContacts 1 PinpointSMSVoiceV2 1 SagemakerEdgeManager 1 Mgn 1 ChimeSDKMeetings 1 CodeGuruReviewer 1 MigrationHubConfig 1 KinesisVideoSignalingChannels 1 SSOAdmin 1 Proton 1 ConnectParticipant 1 ForecastQueryService 1 OpenSearchService 1 MarketplaceCatalog 1 IoTEventsData 1 Schemas 1 ForecastService 1 CodeArtifact 1 LakeFormation 1 EBS 1 SavingsPlans 1 EC2InstanceConnect 1 GroundStation 1 Kendra 1 IoTEvents 1 IoTThingsGraph 1 NimbleStudio 1 ApplicationInsights 1 WorkLink 1 Route53Resolver 1 NetworkFirewall 1