An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.

nuget.org "value-object" keyword

fluxera.queries 10.0.1
An OData v4 query parser and runtime for ASP.NET Core controllers and minimal APIs.
9 versions - Latest release: 5 months ago - 2.46 thousand downloads total - 1 stars on GitHub - 1 maintainer
fluxera.queries.aspnetcore 10.0.1
An OData v4 query parser and runtime for ASP.NET Core controllers and minimal APIs.
9 versions - Latest release: 5 months ago - 1.7 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects 0.2.1
An answer to primitive obsession: single-value DDD value objects for .NET. Annotate a readonly pa...
26 versions - Latest release: 1 day ago - 1.21 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.entityframeworkcore 0.2.1
Entity Framework Core support for AdCodicem value objects: value converters and comparers that st...
25 versions - Latest release: 1 day ago - 1.12 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.dapper 0.2.1
Dapper type handlers for AdCodicem value objects, so raw SQL reads and writes the underlying valu...
25 versions - Latest release: 1 day ago - 1.03 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.testing 0.2.1
An xUnit contract kit for value objects: derive one small class and get the whole behavioural con...
26 versions - Latest release: 1 day ago - 1.03 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.aspnetcore 0.2.1
ASP.NET Core support for AdCodicem value objects: MVC model binding straight from the underlying ...
26 versions - Latest release: 1 day ago - 1.02 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.json 0.2.1
System.Text.Json support for AdCodicem value objects: a converter factory that covers source-gene...
25 versions - Latest release: 1 day ago - 1.09 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.abstractions 0.2.1
Dependency-free contracts for single-value DDD value objects: IValueObject<TSelf, TValue> with st...
25 versions - Latest release: 1 day ago - 2.05 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.openapi 0.2.1
OpenAPI support for AdCodicem value objects on the built-in .NET stack: a schema transformer that...
26 versions - Latest release: 1 day ago - 1.07 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.newtonsoftjson 0.2.1
Newtonsoft.Json support for AdCodicem value objects, for interoperating with code, SDKs and messa...
26 versions - Latest release: 1 day ago - 1.04 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.identifiers 0.2.1
Stripe-style public entity identifiers as value objects. Annotate a readonly partial struct with ...
26 versions - Latest release: 1 day ago - 1.18 thousand downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.identifiers.entityframeworkcore 0.2.1
Entity Framework Core mapping for AdCodicem entity identifiers: fixed-width non-Unicode columns s...
25 versions - Latest release: 1 day ago - 978 downloads total - 1 stars on GitHub - 1 maintainer
adcodicem.valueobjects.fluentvalidation 0.2.1
FluentValidation rules that reuse the rules a value object already enforces, so a request or comm...
26 versions - Latest release: 1 day ago - 1.03 thousand downloads total - 1 stars on GitHub - 1 maintainer
qowaiv 8.2.0
Qowaiv is a (Single) Value Object library. It aims to model reusable (Single) Value Objects that ...
90 versions - Latest release: 15 days ago - 7 dependent packages - 766 thousand downloads total - 97 stars on GitHub - 1 maintainer
qowaiv.componentmodel deprecated
Qowaiv implements common, universal domain objects. These types form the base of your domain model.
9 versions - Latest release: 1 day ago - 2 dependent packages - 23.4 thousand downloads total - 97 stars on GitHub - 1 maintainer
qowaiv.testtools 8.0.0
Qowaiv is a (Single) Value Object library. It aims to model reusable (Single) Value Objects that ...
15 versions - Latest release: over 1 year ago - 45.2 thousand downloads total - 97 stars on GitHub - 1 maintainer
qowaiv.diagnostics.contracts 2.1.0
Qowaiv is a (Single) Value Object library. It aims to model reusable (Single) Value Objects that ...
10 versions - Latest release: 2 months ago - 98 thousand downloads total - 97 stars on GitHub - 1 maintainer
qowaiv.codegeneration 0.0.1-alpha-031
Qowaiv is a (Single) Value Object library. It aims to model reusable (Single) Value Objects that ...
1 version - Latest release: 15 days ago - 97 stars on GitHub
qowaiv.domainmodel.eventsourcing deprecated
Qowaiv implements common, universal domain objects. These types form the base of your domain model.
7 versions - Latest release: 1 day ago - 1 dependent package - 97 stars on GitHub
qowaiv.data.sqlclient 8.0.0
Qowaiv is a (Single) Value Object library. It aims to model reusable (Single) Value Objects that ...
18 versions - Latest release: 7 months ago - 15.6 thousand downloads total - 97 stars on GitHub - 1 maintainer
qowaiv.web 3.2.5
Qowaiv implements common, universal domain objects. These types form the base of your domain model.
15 versions - Latest release: over 7 years ago - 24.6 thousand downloads total - 97 stars on GitHub - 1 maintainer
qowaiv.codegeneration.singlevalueobjects 1.1.5
Qowaiv is a (Single) Value Object library. It aims to model reusable (Single) Value Objects that ...
9 versions - Latest release: 11 months ago - 112 thousand downloads total - 97 stars on GitHub - 1 maintainer
trellis.domaindrivendesign 3.0.0-alpha.158
Building blocks for implementing Domain-Driven Design tactical patterns in C# with functional pro...
18 versions - Latest release: 6 months ago - 44 stars on GitHub
purview.valueobjects 1.0.0-prerelease.10
Source-generated scalar and complex value objects for .NET. Brings F#-style single-case types to ...
10 versions - Latest release: 2 days ago - 1 stars on GitHub
fluxera.repository.litedb 10.0.1
A LiteDB repository implementation.
92 versions - Latest release: 5 months ago - 1 dependent package - 46.8 thousand downloads total - 1 stars on GitHub - 1 maintainer
codometis.typekit 1.0.0
Option and Result types that cannot be misused, and the contracts for strongly-typed value objects.
1 version - Latest release: 4 days ago - 0 downloads total - 0 stars on GitHub - 1 maintainer
codometis.typekit.analyzers 1.0.0
Analyzers for CodoMetis.TypeKit: no default instances, no ignored results, no validation bypass.
1 version - Latest release: 4 days ago - 0 downloads total - 0 stars on GitHub - 1 maintainer
codometis.typekit.aspnetcore 1.0.0
ASP.NET Core integration for CodoMetis.TypeKit: OpenAPI schemas for value objects.
1 version - Latest release: 4 days ago - 0 downloads total - 0 stars on GitHub - 1 maintainer
codometis.typekit.entityframeworkcore 1.0.0
EF Core integration for CodoMetis.TypeKit: value-object converters by convention, and .Value in L...
1 version - Latest release: 4 days ago - 0 downloads total - 0 stars on GitHub - 1 maintainer
codometis.typekit.generators 1.0.0
Compile-time generation of strongly-typed value objects for CodoMetis.TypeKit, built on Metalama.
1 version - Latest release: 4 days ago - 0 downloads total - 0 stars on GitHub - 1 maintainer
fluxera.repository.queries 10.0.1
The OData Queries support for the generic repository.
10 versions - Latest release: 5 months ago - 2.16 thousand downloads total - 1 stars on GitHub - 1 maintainer
aggregatekit 0.2.0
Lightweight building blocks for Domain-Driven Design in .NET
2 versions - Latest release: over 1 year ago - 640 downloads total - 1 maintainer
rootblocks.logging.serilog 0.4.0
Provides a Serilog implementation of the ILogContext from the RootBlocks library + a couple of ea...
4 versions - Latest release: almost 2 years ago - 851 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.serialization 0.4.0
Utilities and extensions for enhanced serialization in the RootBlocks library.
4 versions - Latest release: almost 2 years ago - 993 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.aspnetcore.swashbuckle 0.4.0
Provides Filters to render certain objects from the RootBlocks library correctly in Swagger.
4 versions - Latest release: almost 2 years ago - 1.86 thousand downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.persistence.oracle 0.4.0
Adds Oracle as data provider for the connection factory in RootBlocks.Persistence.
4 versions - Latest release: almost 2 years ago - 930 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.persistence.entityframework 0.4.0
Provides implementations, converters, base classes etc. required to implement RootBlocks with Ent...
3 versions - Latest release: almost 2 years ago - 670 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.persistence 0.4.0
Provides a connection factory for databases, must be used with an actual data provider (MySqlClie...
4 versions - Latest release: almost 2 years ago - 1.73 thousand downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.persistence.npgsql 0.4.0
Adds Npgsql as data provider for the connection factory in RootBlocks.Persistence.
4 versions - Latest release: almost 2 years ago - 859 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.persistence.sqlite 0.4.0
Adds SQLite as data provider for the connection factory in RootBlocks.Persistence.
4 versions - Latest release: almost 2 years ago - 943 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.messaging.mediatr 0.4.0
Provides a MediatR implementation of the IEventPublisher from the RootBlocks library, mainly used...
4 versions - Latest release: almost 2 years ago - 901 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.persistence.mysqlclient 0.4.0
Adds MySqlClient as data provider for the connection factory in RootBlocks.Persistence.
4 versions - Latest release: almost 2 years ago - 923 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.serialization.newtonsoft.json 0.4.0
Helper to add support for JSON Patch requests which currently not supported by System.Text.Json.
4 versions - Latest release: almost 2 years ago - 1.08 thousand downloads total - 1 stars on GitHub - 1 maintainer
rootblocks.persistence.sqlclient 0.4.0
Adds SqlClient as data provider for the connection factory in RootBlocks.Persistence.
4 versions - Latest release: almost 2 years ago - 932 downloads total - 1 stars on GitHub - 1 maintainer
rootblocks 0.4.0
Collection of various abstractions and base classes to help remove boilerplate code and concentra...
5 versions - Latest release: almost 2 years ago - 2.76 thousand downloads total - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.persistence.entityframework
Provides implementations, converters, base classes etc. required to implement BuildingBlocks with...
2 versions - Latest release: about 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.persistence.mysqlclient
Adds MySqlClient as data provider for the connection factory in BuildingBlocks.Persistence.
2 versions - Latest release: 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.persistence
Provides a connection factory for databases, must be used with an actual data provider (MySqlClie...
2 versions - Latest release: 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.logging.serilog
Provides a Serilog implementation of the ILogContext from the BuildingBlocks library + a couple o...
2 versions - Latest release: 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.persistence.npgsql
Adds Npgsql as data provider for the connection factory in BuildingBlocks.Persistence.
2 versions - Latest release: 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.persistence.sqlite
Adds SQLite as data provider for the connection factory in BuildingBlocks.Persistence.
2 versions - Latest release: 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.persistence.sqlclient
Adds SqlClient as data provider for the connection factory in BuildingBlocks.Persistence.
2 versions - Latest release: 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.messaging.mediatr
Provides a MediatR implementation of the IEventPublisher from the BuildingBlocks library, mainly ...
2 versions - Latest release: about 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.serialization.newtonsoft.json
Helper to add support for JSON Patch requests which currently not supported by System.Text.Json.
2 versions - Latest release: 3 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.persistence.oracle
Adds Oracle as data provider for the connection factory in BuildingBlocks.Persistence.
2 versions - Latest release: 3 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.aspnetcore.swashbuckle
Provides Filters to render certain objects from the BuildingBlocks library correctly in Swagger.
3 versions - Latest release: 3 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks.serialization
Utilities and extensions for enhanced serialization in the BuildingBlocks library.
4 versions - Latest release: 2 months ago - 1 stars on GitHub - 1 maintainer
devware.buildingblocks
Collection of various abstractions and base classes to help remove boilerplate code and concentra...
4 versions - Latest release: about 2 months ago - 1 stars on GitHub - 1 maintainer
fluxera.results.aspnetcore 10.0.1
A ASP.NET Core support library for the result object implementation.
8 versions - Latest release: 5 months ago - 1.56 thousand downloads total - 1 stars on GitHub - 1 maintainer
fluxera.results.fluentassertions 10.0.1
A FluentAssertions support libary for the result object implementation.
8 versions - Latest release: 5 months ago - 1.75 thousand downloads total - 1 stars on GitHub - 1 maintainer
fluxera.results 10.0.1
A result object implementation.
8 versions - Latest release: 5 months ago - 2.91 thousand downloads total - 1 stars on GitHub - 1 maintainer
jayden
Jayden is a library that contains reusable components.
5 versions - Latest release: 3 months ago
csharpfunctionalextensions.portable_experimental
CSharpFunctionalExtensions - functional extensions for C#.
1 version - Latest release: 5 days ago - 2,831 stars on GitHub
csharpfunctionalextensionsnet4.0 2.1.1
CSharpFunctionalExtensions - functional extensions for C#.
16 versions - Latest release: about 7 years ago - 1 dependent repositories - 57.4 thousand downloads total - 2,831 stars on GitHub - 1 maintainer
csharpfunctionalextensions 3.7.0
CSharpFunctionalExtensions - functional extensions for C#
156 versions - Latest release: 7 months ago - 135 dependent packages - 38.1 million downloads total - 2,831 stars on GitHub - 1 maintainer
domin.csharpfunctionalextensions 3.6.0-dev
CSharpFunctionalExtensions - functional extensions for C#
1 version - Latest release: 10 months ago - 2,831 stars on GitHub
csharpfunctionalextensions_exp
CSharpFunctionalExtensions - functional extensions for C#.
1 version - Latest release: 5 days ago - 2,831 stars on GitHub
metaphor.csharp.extensions 0.0.0-alpha.0.1
CSharpFunctionalExtensions - functional extensions for C#
1 version - Latest release: about 3 years ago - 2,831 stars on GitHub
csharpfunctionalextensions.strongname 3.7.0
CSharpFunctionalExtensions - functional extensions for C#
15 versions - Latest release: 7 months ago - 22 thousand downloads total - 2,831 stars on GitHub - 1 maintainer
fluentutils.monad deprecated
An implementation of the Result monad
14 versions - Latest release: about 2 months ago - 2.68 thousand downloads total - 3 stars on GitHub - 1 maintainer
jacobi.valueobject 1.5.0
Generate Value Object implementations for (record) struct declarations using a code attribute.
6 versions - Latest release: 7 days ago - 945 downloads total - 0 stars on GitHub - 1 maintainer
bogoware.monads 11.5.0
Provides Maybe and Result Monads suitable to support functional stye in C#.
57 versions - Latest release: 6 months ago - 25.2 thousand downloads total - 13 stars on GitHub - 1 maintainer
coreex.domaindriven 4.0.0
Core .NET extensions and abstractions for the development of backend services.
6 versions - Latest release: 10 days ago - 639 downloads total - 28 stars on GitHub - 1 maintainer
stronglytypedidentifier.aspnetcore 0.2.0
OpenAPI transformers for StronglyTypedIdentifier, so generated identifiers are described as the v...
1 version - Latest release: 9 days ago - 5 downloads total - 1 maintainer
stronglytypedidentifier 0.1.0
Turns an empty partial struct into a strongly-typed identifier: constructor, equality, parsing, J...
1 version - Latest release: 9 days ago - 0 downloads total - 1 maintainer
ericksonlopez.valueobjects.fiscal.peru 2.0.0
Domain-Driven Design (DDD) Value Objects and compliance types for Peruvian taxation (SUNAT, RUC M...
2 versions - Latest release: 10 days ago - 113 downloads total - 0 stars on GitHub - 1 maintainer
ezddd.entity 1.0.0
Core DDD tactical patterns for ezDDD.NET - Entity, AggregateRoot, EsAggregateRoot, and DomainEven...
1 version - Latest release: 3 months ago - 187 downloads total - 0 stars on GitHub - 1 maintainer
badeend.valuecollections.systemtextjson 0.3.2 💰
System.Text.Json converters for Badeend.ValueCollections
9 versions - Latest release: over 1 year ago - 1.62 thousand downloads total - 3 stars on GitHub - 1 maintainer
stronglytypedidentifier.entityframeworkcore 0.2.0
Entity Framework Core value converters for StronglyTypedIdentifier, so a strongly-typed identifie...
2 versions - Latest release: 9 days ago - 0 downloads total - 1 maintainer
badeend.valuecollections.newtonsoftjson 0.3.2 💰
Newtonsoft.Json converters for Badeend.ValueCollections
7 versions - Latest release: over 1 year ago - 1.19 thousand downloads total - 3 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects.dapper 2.0.0
Dapper TypeHandler adapters for persistence of EricksonLopez.ValueObjects in relational databases...
2 versions - Latest release: 10 days ago - 107 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.mapper.domainprimitives 2.0.0
DomainPrimitives integration for EricksonLopez.Mapper. Enables mapping strongly-typed IDs and val...
2 versions - Latest release: 9 days ago - 100 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects.analyzers 2.0.0
Roslyn Analyzers enforcing DDD Value Object invariants, immutability, and safety rules.
2 versions - Latest release: 10 days ago - 95 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects.entityframeworkcore 2.0.0
Entity Framework Core integration for EricksonLopez.ValueObjects. Provides NativeAOT-ready ValueC...
2 versions - Latest release: 10 days ago - 108 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects.domainprimitives 2.0.0
DomainPrimitives bridge and adapter layer for EricksonLopez.ValueObjects. Enables bidirectional c...
2 versions - Latest release: 10 days ago - 116 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects.fiscal.chile 2.0.0
Domain-Driven Design (DDD) Value Objects and compliance types for Chilean taxation (SII, RUT Modu...
2 versions - Latest release: 10 days ago - 114 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects.fiscal.mexico 2.0.0
Domain-Driven Design (DDD) Value Objects and compliance types for Mexican taxation (SAT, RFC con ...
2 versions - Latest release: 10 days ago - 109 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects 2.0.0
Pure domain Value Object infrastructure for high-performance, AOT-first DDD applications in .NET ...
2 versions - Latest release: 10 days ago - 200 downloads total - 0 stars on GitHub - 1 maintainer
ericksonlopez.valueobjects.serialization.json 2.0.0
System.Text.Json Native AOT-compatible serialization adapters for EricksonLopez.ValueObjects.
2 versions - Latest release: 10 days ago - 111 downloads total - 0 stars on GitHub - 1 maintainer
fluentutils.mediatr.pagination.aspnetcore 1.2.15
A set of utils for returning pagination results when using MediatR in AspNetCore Web APIs.
8 versions - Latest release: over 2 years ago - 5.31 thousand downloads total - 3 stars on GitHub - 1 maintainer
primitively.aspnetcore.swaggergen 1.4.22
A library which provides ASP.NET Core Open Api Schema support for types produced by the Primitive...
21 versions - Latest release: almost 2 years ago - 4.96 thousand downloads total - 9 stars on GitHub - 1 maintainer
primitively.aspnetcore 1.1.2
A library which provides ASP.NET Core Model Binding and Open Api Schema support for types produce...
33 versions - Latest release: over 3 years ago - 15.7 thousand downloads total - 9 stars on GitHub - 1 maintainer
fluxera.repository.abstractions 10.0.1
The abstractions for the generic repository implementation.
92 versions - Latest release: 5 months ago - 2 dependent packages - 121 thousand downloads total - 1 stars on GitHub - 1 maintainer
fluxera.extensions.localization.abstractions 10.0.1
The abstactions for the custom extensions for localization.
68 versions - Latest release: 5 months ago - 1 dependent package - 70.2 thousand downloads total - 1 stars on GitHub - 1 maintainer
primitively 1.4.22
A C# source generator that promotes the benefits of type-safety by encapsulating primitive types ...
34 versions - Latest release: almost 2 years ago - 21 thousand downloads total - 9 stars on GitHub - 1 maintainer
fluxera.extensions.http 10.0.1
The custom extensions for http client.
58 versions - Latest release: 5 months ago - 2 dependent packages - 37.9 thousand downloads total - 1 stars on GitHub - 1 maintainer
jorgecostamacia.valueobject.efconverter 8.0.0
Native EF Core value converters for JorgeCostaMacia.ValueObject value objects — one converter per...
20 versions - Latest release: 17 days ago - 1.94 thousand downloads total - 1 stars on GitHub - 1 maintainer
fluentutils.enumextensions 1.2.15
A set of utils for working with enums.
7 versions - Latest release: over 2 years ago - 13.8 thousand downloads total - 3 stars on GitHub - 1 maintainer
hamedstack.aggregateroot.entityframeworkcore
Package Description
1 version - Latest release: about 2 months ago - 1 stars on GitHub - 1 maintainer