Ecosyste.ms: Packages

An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.

nuget.org maintainers: awscpp

awssdkcpp-cloudfront.symbols 0.12.20160128.12
Symbols for package 'AWSSDKCPP-CloudFront'. This package should not likely be installed. (This i...
1 version - Latest release: almost 8 years ago - 1.3 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.3% on nuget.org
awssdkcpp-greengrass 1.6.20170607.25
AWS Greengrass Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++...
134 versions - Latest release: over 5 years ago - 167 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.2% on nuget.org
awssdkcpp-batch 1.6.20160810.25
AWS Batch Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 11 o...
166 versions - Latest release: over 5 years ago - 199 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-storagegateway.symbols 0.12.20130630.12
Symbols for package 'AWSSDKCPP-StorageGateway'. This package should not likely be installed. (Th...
1 version - Latest release: almost 8 years ago - 1.21 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.2% on nuget.org
awssdkcpp-cloudwatchlogs.redist 1.6.20140328.25
Redistributable components for package 'AWSSDKCPP-CloudWatchLogs'. This package should only be in...
220 versions - Latest release: over 5 years ago - 1 dependent package - 308 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.7% on nuget.org
awssdkcpp-kinesisvideomedia.redist 1.6.20170930.25
Redistributable components for package 'AWSSDKCPP-KinesisVideoMedia'. This package should only be...
73 versions - Latest release: over 5 years ago - 1 dependent package - 84.3 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-servicecatalog 1.6.20151210.25
AWS Service Catalog Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (versio...
214 versions - Latest release: over 5 years ago - 295 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.2% on nuget.org
awssdkcpp-ecs.redist 1.6.20141113.25
Redistributable components for package 'AWSSDKCPP-ECS'. This package should only be installed as ...
220 versions - Latest release: over 5 years ago - 1 dependent package - 303 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.2% on nuget.org
awssdkcpp-gamelift.redist 1.6.20151001.25
Redistributable components for package 'AWSSDKCPP-GameLift'. This package should only be installe...
219 versions - Latest release: over 5 years ago - 1 dependent package - 1 dependent repositories - 457 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-iot1clickdevicesservice.redist 1.6.20180514.25
Redistributable components for package 'AWSSDKCPP-IoT1ClickDevicesService'. This package should o...
25 versions - Latest release: over 5 years ago - 1 dependent package - 25.9 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-signer.redist 1.6.20170825.25
Redistributable components for package 'AWSSDKCPP-Signer'. This package should only be installed ...
5 versions - Latest release: over 5 years ago - 1 dependent package - 5.26 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.2% on nuget.org
awssdkcpp-lexruntimeservice 1.6.20161128.25
Amazon Lex Runtime Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ ...
165 versions - Latest release: over 5 years ago - 382 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-cloudhsm 1.6.20140530.25
Amazon CloudHSM Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C+...
221 versions - Latest release: over 5 years ago - 273 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-core.symbols 0.12.12
Symbols for package 'AWSSDKCPP-Core'. This package should not likely be installed. (This is not ...
1 version - Latest release: almost 8 years ago - 1.37 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.4% on nuget.org
awssdkcpp-dynamodbstreams.redist 1.6.20120810.25
Redistributable components for package 'AWSSDKCPP-DynamoDBStreams'. This package should only be i...
134 versions - Latest release: over 5 years ago - 1 dependent package - 164 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-snowball 1.6.20160630.25
Amazon Import/Export Snowball Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C...
202 versions - Latest release: over 5 years ago - 418 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-iot 1.6.20150528.25
AWS IoT Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 11 or ...
220 versions - Latest release: over 5 years ago - 949 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-ecr 1.6.20150921.25
Amazon EC2 Container Registry Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C...
220 versions - Latest release: over 5 years ago - 282 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-clouddirectory.redist 1.6.20170111.25
Redistributable components for package 'AWSSDKCPP-CloudDirectory'. This package should only be in...
169 versions - Latest release: over 5 years ago - 1 dependent package - 222 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-elasticbeanstalk 1.6.20101201.25
AWS Elastic Beanstalk Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (vers...
220 versions - Latest release: over 5 years ago - 290 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-codedeploy 1.6.20141006.25
AWS CodeDeploy Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++...
220 versions - Latest release: over 5 years ago - 288 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-directconnect 1.6.20121025.25
AWS Direct Connect Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version...
220 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.8% on nuget.org
awssdkcpp-cognitoidentityprovider 1.6.20160418.25
Amazon Cognito Identity Provider Client for the AWS SDK for C++. AWS SDK for C++ provides a moder...
219 versions - Latest release: over 5 years ago - 2 dependent repositories - 318 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-cloudsearchdomain 1.6.20130101.25
Amazon CloudSearch Domain Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (...
221 versions - Latest release: over 5 years ago - 265 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-cloudsearch 1.6.20130101.25
Amazon CloudSearch Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version...
220 versions - Latest release: over 5 years ago - 286 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 6.2% on nuget.org
awssdkcpp-sqs 1.6.20121105.25
Amazon Simple Queue Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++...
218 versions - Latest release: over 5 years ago - 1 dependent repositories - 311 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.8% on nuget.org
awssdkcpp-ses 1.6.20101201.25
Amazon Simple Email Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++...
219 versions - Latest release: over 5 years ago - 2 dependent repositories - 358 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-workspaces 1.6.20150408.25
Amazon WorkSpaces Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version ...
218 versions - Latest release: over 5 years ago - 259 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-acm.symbols 0.12.20151208.12
Symbols for package 'AWSSDKCPP-ACM'. This package should not likely be installed. (This is not t...
1 version - Latest release: almost 8 years ago - 1.24 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.1% on nuget.org
awssdkcpp-identitymanagement.redist 1.6.25
Redistributable components for package 'AWSSDKCPP-IdentityManagement'. This package should only b...
135 versions - Latest release: over 5 years ago - 1 dependent package - 2 dependent repositories - 172 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-cloudhsm.symbols 0.12.20140530.12
Symbols for package 'AWSSDKCPP-CloudHSM'. This package should not likely be installed. (This is ...
1 version - Latest release: almost 8 years ago - 1.27 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-opsworks.redist 1.6.20130218.25
Redistributable components for package 'AWSSDKCPP-OpsWorks'. This package should only be installe...
220 versions - Latest release: over 5 years ago - 1 dependent package - 309 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-swf.symbols 0.12.20120125.12
Symbols for package 'AWSSDKCPP-SWF'. This package should not likely be installed. (This is not t...
1 version - Latest release: almost 8 years ago - 1.27 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.3% on nuget.org
awssdkcpp-dynamodbstreams 1.6.20120810.25
Amazon DynamoDB Streams Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
134 versions - Latest release: over 5 years ago - 144 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-elasticsearchservice 1.6.20150101.25
Amazon Elasticsearch Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C+...
220 versions - Latest release: over 5 years ago - 262 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-codepipeline 1.6.20150709.25
AWS CodePipeline Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C...
220 versions - Latest release: over 5 years ago - 278 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.9% on nuget.org
awssdkcpp-autoscalingplans.redist 1.6.20180106.25
Redistributable components for package 'AWSSDKCPP-AutoScalingPlans'. This package should only be ...
57 versions - Latest release: over 5 years ago - 1 dependent package - 67 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.6% on nuget.org
awssdkcpp-mediastore 1.6.20170901.25
AWS Elemental MediaStore Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (v...
73 versions - Latest release: over 5 years ago - 76.2 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-cloudwatchevents 1.6.20151007.25
Amazon CloudWatch Events Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (v...
221 versions - Latest release: over 5 years ago - 278 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.4% on nuget.org
awssdkcpp-transfer.redist 1.6.25
Redistributable components for package 'AWSSDKCPP-Transfer'. This package should only be installe...
134 versions - Latest release: over 5 years ago - 1 dependent package - 1 dependent repositories - 184 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 6.1% on nuget.org
awssdkcpp-dynamodb 1.6.20120810.25
Amazon DynamoDB Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C+...
220 versions - Latest release: over 5 years ago - 1 dependent repositories - 749 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.7% on nuget.org
awssdkcpp-pricing.redist 1.6.20171015.25
Redistributable components for package 'AWSSDKCPP-Pricing'. This package should only be installed...
79 versions - Latest release: over 5 years ago - 1 dependent package - 93.7 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-configservice 1.6.20141112.25
AWS Config Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 11 ...
219 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.2% on nuget.org
awssdkcpp-elasticloadbalancing.redist 1.6.20120601.25
Redistributable components for package 'AWSSDKCPP-ElasticLoadBalancing'. This package should only...
220 versions - Latest release: over 5 years ago - 1 dependent package - 304 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-elasticsearchservice.symbols 0.12.20150101.12
Symbols for package 'AWSSDKCPP-ElasticsearchService'. This package should not likely be installed...
1 version - Latest release: almost 8 years ago - 1.28 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-machinelearning 1.6.20141212.25
Amazon Machine Learning Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
219 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-elastictranscoder 1.6.20120925.25
Amazon Elastic Transcoder Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (...
219 versions - Latest release: over 5 years ago - 265 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-ssm 1.6.20141106.25
Amazon Simple Systems Manager (SSM) Client for the AWS SDK for C++. AWS SDK for C++ provides a mo...
212 versions - Latest release: over 5 years ago - 335 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.1% on nuget.org
awssdkcpp-autoscaling 1.6.20110101.25
Auto Scaling Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 1...
221 versions - Latest release: over 5 years ago - 301 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.2% on nuget.org
awssdkcpp-machinelearning.redist 1.6.20141212.25
Redistributable components for package 'AWSSDKCPP-MachineLearning'. This package should only be i...
220 versions - Latest release: over 5 years ago - 1 dependent package - 292 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.7% on nuget.org
awssdkcpp-mediapackage.redist 1.6.20171012.25
Redistributable components for package 'AWSSDKCPP-MediaPackage'. This package should only be inst...
73 versions - Latest release: over 5 years ago - 1 dependent package - 83.3 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 9.2% on nuget.org
awssdkcpp-guardduty.redist 1.6.20171128.25
Redistributable components for package 'AWSSDKCPP-GuardDuty'. This package should only be install...
73 versions - Latest release: over 5 years ago - 1 dependent package - 82.6 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.7% on nuget.org
awssdkcpp-resourcegroups.redist 1.6.20171127.25
Redistributable components for package 'AWSSDKCPP-ResourceGroups'. This package should only be in...
73 versions - Latest release: over 5 years ago - 1 dependent package - 84.2 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-route53domains 1.6.20140515.25
Amazon Route 53 Domains Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
220 versions - Latest release: over 5 years ago - 270 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-lexruntimeservice.redist 1.6.20161128.25
Redistributable components for package 'AWSSDKCPP-LexRuntimeService'. This package should only be...
165 versions - Latest release: over 5 years ago - 1 dependent package - 352 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 3.7% on nuget.org
awssdkcpp-sts.redist 1.6.20110615.25
Redistributable components for package 'AWSSDKCPP-STS'. This package should only be installed as ...
219 versions - Latest release: over 5 years ago - 1 dependent package - 3 dependent repositories - 340 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-configservice.redist 1.6.20141112.25
Redistributable components for package 'AWSSDKCPP-ConfigService'. This package should only be ins...
220 versions - Latest release: over 5 years ago - 1 dependent package - 291 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-importexport.symbols 0.12.20100601.12
Symbols for package 'AWSSDKCPP-ImportExport'. This package should not likely be installed. (This...
1 version - Latest release: almost 8 years ago - 1.21 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.2% on nuget.org
awssdkcpp-ecr.redist 1.6.20150921.25
Redistributable components for package 'AWSSDKCPP-ECR'. This package should only be installed as ...
220 versions - Latest release: over 5 years ago - 1 dependent package - 303 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.6% on nuget.org
awssdkcpp-alexaforbusiness 1.6.20171109.25
Alexa For Business Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version...
73 versions - Latest release: over 5 years ago - 91.5 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-route53 1.6.20130401.25
Amazon Route 53 Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C+...
220 versions - Latest release: over 5 years ago - 292 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.3% on nuget.org
awssdkcpp-athena 1.6.20170518.25
Amazon Athena Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ ...
134 versions - Latest release: over 5 years ago - 155 thousand downloads total - 1,808 stars on GitHub - 1 maintainer
Top 5.3% on nuget.org
awssdkcpp-route53domains.redist 1.6.20140515.25
Redistributable components for package 'AWSSDKCPP-Route53Domains'. This package should only be in...
220 versions - Latest release: over 5 years ago - 1 dependent package - 302 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 4.2% on nuget.org
awssdkcpp-iam 1.6.20100508.25
AWS Identity and Access Management Client for the AWS SDK for C++. AWS SDK for C++ provides a mod...
218 versions - Latest release: over 5 years ago - 1 dependent package - 1 dependent repositories - 435 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 6.7% on nuget.org
awssdkcpp-macie.redist 1.6.20171219.25
Redistributable components for package 'AWSSDKCPP-Macie'. This package should only be installed a...
24 versions - Latest release: over 5 years ago - 1 dependent package - 24.9 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 8.6% on nuget.org
awssdkcpp-macie 1.6.20171219.25
Amazon Macie Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 1...
24 versions - Latest release: over 5 years ago - 22.3 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 8.7% on nuget.org
awssdkcpp-dlm 1.6.20180112.25
Amazon Data Lifecycle Manager Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C...
21 versions - Latest release: over 5 years ago - 20.3 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-iam.symbols 0.12.20100508.12
Symbols for package 'AWSSDKCPP-IAM'. This package should not likely be installed. (This is not t...
1 version - Latest release: almost 8 years ago - 1.29 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-importexport.redist 1.6.20100601.25
Redistributable components for package 'AWSSDKCPP-ImportExport'. This package should only be inst...
220 versions - Latest release: over 5 years ago - 1 dependent package - 297 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.2% on nuget.org
awssdkcpp-xray 1.6.20160412.25
AWS X-Ray Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C++ 11 o...
179 versions - Latest release: over 5 years ago - 206 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.3% on nuget.org
awssdkcpp-marketplaceentitlementservice 1.6.20170111.25
AWS Marketplace Entitlement Service Client for the AWS SDK for C++. AWS SDK for C++ provides a mo...
112 versions - Latest release: over 5 years ago - 152 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-datapipeline 1.6.20121029.25
AWS Data Pipeline Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version ...
219 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.5% on nuget.org
awssdkcpp-cloudhsmv2.redist 1.6.20170428.25
Redistributable components for package 'AWSSDKCPP-CloudHSMV2'. This package should only be instal...
113 versions - Latest release: over 5 years ago - 1 dependent package - 143 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-codecommit.symbols 0.12.20150413.12
Symbols for package 'AWSSDKCPP-CodeCommit'. This package should not likely be installed. (This i...
1 version - Latest release: almost 8 years ago - 1.26 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
awssdkcpp-cloudsearch.symbols 0.12.20130101.12
Symbols for package 'AWSSDKCPP-CloudSearch'. This package should not likely be installed. (This ...
1 version - Latest release: almost 8 years ago - 1.33 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-batch.redist 1.6.20160810.25
Redistributable components for package 'AWSSDKCPP-Batch'. This package should only be installed a...
166 versions - Latest release: over 5 years ago - 1 dependent package - 220 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 9.1% on nuget.org
awssdkcpp-appsync.redist 1.6.20170725.25
Redistributable components for package 'AWSSDKCPP-AppSync'. This package should only be installed...
73 versions - Latest release: over 5 years ago - 1 dependent package - 89.5 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.4% on nuget.org
awssdkcpp-sms.redist 1.6.20161024.25
Redistributable components for package 'AWSSDKCPP-SMS'. This package should only be installed as ...
134 versions - Latest release: over 5 years ago - 1 dependent package - 234 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.4% on nuget.org
awssdkcpp-lexmodelbuildingservice.redist 1.6.20170419.25
Redistributable components for package 'AWSSDKCPP-LexModelBuildingService'. This package should o...
136 versions - Latest release: over 5 years ago - 1 dependent package - 164 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.7% on nuget.org
awssdkcpp-iotjobsdataplane.redist 1.6.20170929.25
Redistributable components for package 'AWSSDKCPP-IoTJobsDataPlane'. This package should only be ...
73 versions - Latest release: over 5 years ago - 1 dependent package - 85.2 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.9% on nuget.org
awssdkcpp-costexplorer.redist 1.6.20171025.25
Redistributable components for package 'AWSSDKCPP-CostExplorer'. This package should only be inst...
57 versions - Latest release: over 5 years ago - 1 dependent package - 74 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.3% on nuget.org
awssdkcpp-lexmodelbuildingservice 1.6.20170419.25
Amazon Lex Model Building Service Client for the AWS SDK for C++. AWS SDK for C++ provides a mode...
136 versions - Latest release: over 5 years ago - 161 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.3% on nuget.org
awssdkcpp-sms 1.6.20161024.25
AWS Server Migration Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C+...
134 versions - Latest release: over 5 years ago - 283 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-ec2 1.6.20161115.25
Amazon Elastic Compute Cloud Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C+...
185 versions - Latest release: over 5 years ago - 418 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.2% on nuget.org
awssdkcpp-elasticache.redist 1.6.20150202.25
Redistributable components for package 'AWSSDKCPP-ElastiCache'. This package should only be insta...
220 versions - Latest release: over 5 years ago - 1 dependent package - 319 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.2% on nuget.org
awssdkcpp-costandusagereportservice 1.6.20170106.25
AWS Cost and Usage Report Service Client for the AWS SDK for C++. AWS SDK for C++ provides a mode...
173 versions - Latest release: over 5 years ago - 187 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.3% on nuget.org
awssdkcpp-health.redist 1.6.20160804.25
Redistributable components for package 'AWSSDKCPP-Health'. This package should only be installed ...
180 versions - Latest release: over 5 years ago - 1 dependent package - 229 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-marketplacemetering 1.6.20160114.25
AWSMarketplace Metering Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
220 versions - Latest release: over 5 years ago - 268 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 9.2% on nuget.org
awssdkcpp-mq.redist 1.6.20171127.25
Redistributable components for package 'AWSSDKCPP-MQ'. This package should only be installed as a...
73 versions - Latest release: over 5 years ago - 1 dependent package - 84.2 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.7% on nuget.org
awssdkcpp-medialive.redist 1.6.20171014.25
Redistributable components for package 'AWSSDKCPP-MediaLive'. This package should only be install...
73 versions - Latest release: over 5 years ago - 1 dependent package - 87.1 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.3% on nuget.org
awssdkcpp-cloudhsmv2 1.6.20170428.25
AWS CloudHSM V2 Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version C+...
113 versions - Latest release: over 5 years ago - 130 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.6% on nuget.org
awssdkcpp-medialive 1.6.20171014.25
AWS Elemental MediaLive Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ve...
73 versions - Latest release: over 5 years ago - 89.4 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.4% on nuget.org
awssdkcpp-organizations.redist 1.6.20161128.25
Redistributable components for package 'AWSSDKCPP-Organizations'. This package should only be ins...
157 versions - Latest release: over 5 years ago - 1 dependent package - 270 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.6% on nuget.org
awssdkcpp-servicediscovery 1.6.20170314.25
Amazon Route 53 Auto Naming Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++...
72 versions - Latest release: over 5 years ago - 76.1 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 7.1% on nuget.org
awssdkcpp-cloudformation 1.6.20100515.25
AWS CloudFormation Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (version...
221 versions - Latest release: over 5 years ago - 298 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 5.3% on nuget.org
awssdkcpp-iot.redist 1.6.20150528.25
Redistributable components for package 'AWSSDKCPP-IoT'. This package should only be installed as ...
220 versions - Latest release: over 5 years ago - 1 dependent package - 513 thousand downloads total - 1,866 stars on GitHub - 2 maintainers
Top 7.3% on nuget.org
awssdkcpp-dax 1.6.20170419.25
Amazon DynamoDB Accelerator (DAX) Client for the AWS SDK for C++. AWS SDK for C++ provides a mode...
112 versions - Latest release: over 5 years ago - 128 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 8.2% on nuget.org
awssdkcpp-connect 1.6.20170808.25
Amazon Connect Service Client for the AWS SDK for C++. AWS SDK for C++ provides a modern C++ (ver...
32 versions - Latest release: over 5 years ago - 32.4 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
Top 5.5% on nuget.org
awssdkcpp-marketplaceentitlementservice.redist 1.6.20170111.25
Redistributable components for package 'AWSSDKCPP-MarketplaceEntitlementService'. This package sh...
112 versions - Latest release: over 5 years ago - 1 dependent package - 132 thousand downloads total - 1,866 stars on GitHub - 1 maintainer
awssdkcpp-cloudwatchlogs.symbols 0.12.20140328.12
Symbols for package 'AWSSDKCPP-CloudWatchLogs'. This package should not likely be installed. (Th...
1 version - Latest release: almost 8 years ago - 1.22 thousand downloads total - 1,866 stars on GitHub - 2 maintainers