Ecosyste.ms: Packages
An open API service providing package, version and dependency metadata of many open source software ecosystems and registries.
Top 0.1% dependent packages on proxy.golang.org
Top 0.4% dependent repos on proxy.golang.org
Top 8.4% forks on proxy.golang.org
Top 1.4% docker downloads on proxy.golang.org
proxy.golang.org : github.com/aws/constructs-go/constructs/v10
A programming model for software-defined state
Registry
-
Source
- Documentation
- JSON
purl: pkg:golang/github.com/aws/constructs-go/constructs/v10
License: Apache-2.0
Latest release: 7 months ago
First release: about 3 years ago
Namespace: github.com/aws/constructs-go/constructs
Dependent packages: 1,069
Dependent repositories: 257
Stars: 8 on GitHub
Forks: 5 on GitHub
Docker dependents: 4
Docker downloads: 1,451
See more repository details: repos.ecosyste.ms
Last synced: 8 days ago
github.com/rsoury/buyte v0.0.0-20211012104802-cb7f019bbe45
Apple Pay and Google Pay in a single install. Digital Wallet Payment Orchestration built on a Ser...1 version - Latest release: over 2 years ago - 6 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsservicecatalogappregistryalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::ServiceCatalogAppRegistry3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkassertionsalpha/v2 v2.0.0-rc.24
An assertion library for use with CDK Apps6 versions - Latest release: over 2 years ago - 135 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsapprunneralpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::AppRunner3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawssyntheticsalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Synthetics3 versions - Latest release: over 2 years ago - 158 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawskinesisfirehosedestinationsalpha/v2 v2.0.0-rc.24
CDK Destinations Constructs for AWS Kinesis Firehose3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsroute53resolveralpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Route53Resolver3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsappsyncalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::AppSync3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsneptunealpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Neptune3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawskinesisfirehosealpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::KinesisFirehose3 versions - Latest release: over 2 years ago - 1 dependent package - 155 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawslambdagoalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS Lambda in Golang3 versions - Latest release: over 2 years ago - 137 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsmskalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::MSK3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsgluealpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Glue3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawscloud9alpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Cloud93 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawskinesisanalyticsflinkalpha/v2 v2.0.0-rc.24
A CDK Construct Library for Kinesis Analytics Flink applications3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsamplifyalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Amplify3 versions - Latest release: over 2 years ago - 135 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawslambdapythonalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS Lambda in Python3 versions - Latest release: over 2 years ago - 158 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsredshiftalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Redshift3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsivsalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::IVS3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsservicecatalogalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::ServiceCatalog3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawscodestaralpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::CodeStar3 versions - Latest release: over 2 years ago - 157 stars on GitHub
github.com/aws/aws-cdk-go/awscdkawsbatchalpha/v2 v2.0.0-rc.24
The CDK Construct Library for AWS::Batch3 versions - Latest release: over 2 years ago - 135 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructscore/v2 v2.2.0
Core CDK Construct for patterns library1 version - Latest release: over 2 years ago - 51 dependent packages - 1 dependent repositories - 0 stars on GitHub
github.com/testsonly/bark/v2 v2.0.0-20220101110349-341f44af06e4
Core CDK Construct for patterns library2 versions - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawskinesisfirehoses3/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon Kinesis Data Firehose delivery strea...1 version - Latest release: over 2 years ago - 4 dependent packages - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawseventbridgelambda/v2 v2.2.0
CDK Constructs for deploying AWS Events Rule that inveokes AWS Lambda1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawss3lambda/v2 v2.2.0
CDK Constructs for AWS S3 to AWS Lambda integration1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawseventbridgekinesisfirehoses3/v2 v2.2.0
CDK Constructs for Amazon CloudWatch Events Rule to Amazon Kinesis Firehose to Amazon S3 integrat...1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawscloudfronts3/v2 v2.2.0
CDK Constructs for AWS Cloudfront to AWS S3 integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawscognitoapigatewaylambda/v2 v2.2.0
CDK Constructs for AWS Cognito to AWS API Gateway to AWS Lambda integration1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawswafwebaclalb/v2 v2.2.0
CDK constructs for defining an AWS web WAF connected to an Application Load Balancer.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsapigatewaykinesisstreams/v2 v2.2.0
CDK Constructs for AWS API Gateway and Amazon Kinesis Data Streams integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawswafwebaclcloudfront/v2 v2.2.0
CDK constructs for defining an AWS web WAF connected to Amazon CloudFront.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsiotsqs/v2 v2.2.0
CDK Constructs for AWS IoT to AWS SQS integration1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdastepfunctions/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and an AWS Step Function.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawss3sqs/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon S3 bucket and an Amazon SQS queue.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawskinesisstreamslambda/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon Kinesis Data Stream and an AWS Lambd...1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsiotkinesisstreams/v2 v2.2.0
CDK Constructs for AWS IoT to AWS Kinesis Data Stream.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawssnslambda/v2 v2.2.0
CDK Constructs for AWS SNS to AWS Lambda integration1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdaeventbridge/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and an Amazon EventBridge.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsapigatewaydynamodb/v2 v2.2.0
CDK Constructs for AWS API Gateway and Amazon DynamoDB integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdasagemakerendpoint/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and an Amazon SageMaker...1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsalblambda/v2 v2.2.0
CDK Constructs for Application Load Balancer to AWS Lambda integration1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsapigatewayiot/v2 v2.2.0
CDK constructs to proxy communication to IotCore using a APIGateway(REST).1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsdynamodbstreamslambdaelasticsearchkibana/v2 v2.2.0
CDK Constructs for Amazon Dynamodb streams to AWS Lambda to AWS Elasticsearch with Kibana integra...1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsroute53alb/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon Route53 domain and an Application Lo...1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdassmstringparameter/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and AWS Systems Manager...1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdas3/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and an Amazon S3 bucket.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawskinesisstreamskinesisfirehoses3/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon Kinesis Data Stream (KDS), Amazon Ki...1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdasns/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and an Amazon SNS topic.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsapigatewaysagemakerendpoint/v2 v2.2.0
CDK Constructs for AWS API Gateway and Amazon SageMaker Endpoint integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawskinesisfirehoses3andkinesisanalytics/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon Kinesis Data Firehose delivery strea...1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawseventbridgesqs/v2 v2.2.0
CDK Constructs for deploying AWS Eventbridge that invokes AWS SQS1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawscloudfrontapigateway/v2 v2.2.0
CDK Constructs for AWS Cloudfront to AWS API Gateway integration.1 version - Latest release: over 2 years ago - 2 dependent packages - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawssnssqs/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon SNS topic and an Amazon SQS queue.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawseventbridgekinesisstreams/v2 v2.2.0
CDK Constructs for deploying Amazon CloudWatch Events Rule that invokes Amazon Kinesis Data Stream1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdasqslambda/v2 v2.2.0
CDK construct that provisions (1) an AWS Lambda function that is configured to send messages to a...1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawseventbridgestepfunctions/v2 v2.2.0
CDK Constructs for deploying AWS Events Rule that invokes AWS Step Functions1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawscloudfrontmediastore/v2 v2.2.0
CDK Constructs for Amazon CloudFront to AWS Elemental MediaStore integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsiotkinesisfirehoses3/v2 v2.2.0
CDK Constructs for AWS IoT to AWS Kinesis Firehose to AWS S3 integration.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawswafwebaclapigateway/v2 v2.2.0
CDK constructs for defining an AWS web WAF connected to Amazon API Gateway REST API.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsapigatewaylambda/v2 v2.2.0
CDK constructs for defining an interaction between an API Gateway and a Lambda function.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsiotlambda/v2 v2.2.0
CDK Constructs for AWS IoT to AWS Lambda integration1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdaelasticsearchkibana/v2 v2.2.0
CDK Constructs for AWS Lambda to AWS Elasticsearch with Kibana integration1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsiotlambdadynamodb/v2 v2.2.0
CDK Constructs for AWS IoT to AWS Lambda to AWS DyanmoDB integration.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsapigatewaysqs/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and an Amazon S3 bucket.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawskinesisstreamsgluejob/v2 v2.2.0
CDK Constructs for streaming data from AWS Kinesis Data Stream for Glue ETL custom Job processing1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdasqs/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and an Amazon SQS queue.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawscloudfrontapigatewaylambda/v2 v2.2.0
CDK Constructs for AWS Cloudfront to AWS API Gateway to AWS Lambda integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawss3stepfunctions/v2 v2.2.0
CDK Constructs for AWS S3 to AWS Step Functions integration1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawssqslambda/v2 v2.2.0
CDK constructs for defining an interaction between an Amazon SQS queue and an AWS Lambda function.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawsdynamodbstreamslambda/v2 v2.2.0
CDK Constructs for AWS DynamoDB Streams to AWS Lambda integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdasecretsmanager/v2 v2.2.0
CDK constructs for defining an interaction between an AWS Lambda function and AWS Secrets Manager.1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawslambdadynamodb/v2 v2.2.0
CDK Constructs for AWS Lambda to AWS DynamoDB integration.1 version - Latest release: over 2 years ago - 1 dependent package - 1 dependent repositories - 0 stars on GitHub
github.com/christian-korneck/awssc-go-dist/awssolutionsconstructsawseventbridgesns/v2 v2.2.0
CDK Constructs for deploying AWS Events Rule that invokes AWS SNS1 version - Latest release: over 2 years ago - 0 stars on GitHub
github.com/masahide/discord-bot v0.0.0-20220123004653-8100809de0eb
1 version - Latest release: over 2 years ago - 0 stars on GitHubgithub.com/Hortau/cdktf-provider-aws-go v0.3.0
Terraform CDK aws Provider3 versions - Latest release: about 2 years ago - 1 stars on GitHub
github.com/hortau/cdktf-provider-aws-go v0.3.0
hashicorp_aws3 versions - Latest release: about 2 years ago - 1 stars on GitHub
github.com/cliffom/sst-bff-demo v0.0.0-20220224190907-7f6a30448aa8
A demonstration of how to use SST to build and deploy a GraphQL endpoint with backing services wr...1 version - Latest release: about 2 years ago - 5 stars on GitHub
github.com/a-h/cwexport v0.0.60 💰
Export CloudWatch Metrics to a sink.7 versions - Latest release: about 2 years ago - 1 stars on GitHub
github.com/rubenfonseca/state-machine/rubenfonsecastatemachine v0.0.14
A Step Function state machine construct focused on working well with the Workflow Studio3 versions - Latest release: about 2 years ago - 0 stars on GitHub
github.com/rubenfonseca/state-machine/statemachine v0.0.15
A Step Function state machine construct focused on working well with the Workflow Studio2 versions - Latest release: about 2 years ago - 0 stars on GitHub
github.com/p6m7g8/p6-cdk-namer/p6cdknamer v0.8.30
Sets the AWS IAM Account Alias with a Custom Resource25 versions - Latest release: about 2 years ago - 0 stars on GitHub
github.com/jesseblack82/constructs v0.0.0-20220417014207-178877d13ba1
1 version - Latest release: about 2 years ago - 0 stars on GitHubgithub.com/aws/aws-cdk-go/awscdkservicecatalogalpha/v2 v2.22.0-alpha.0
The CDK Construct Library for AWS::ServiceCatalog34 versions - Latest release: about 2 years ago - 157 stars on GitHub
github.com/opencdk8s/cdk8s-cluster-autoscaler-aws-go/opencdk8scdk8sclusterautoscaleraws v0.1.4
@opencdk8s/cdk8s-cluster-autoscaler-aws2 versions - Latest release: about 2 years ago - 0 stars on GitHub
github.com/opencdk8s/cdk8s-external-dns-route53-go/opencdk8scdk8sexternaldnsroute53 v0.1.4
@opencdk8s/cdk8s-external-dns-route532 versions - Latest release: about 2 years ago - 0 stars on GitHub
github.com/rubenfonseca/state-machine-go/statemachine v0.0.19
A Step Function state machine construct focused on working well with the Workflow Studio4 versions - Latest release: about 2 years ago - 0 stars on GitHub
github.com/cdk8s-team/cdk8s-plus-go/cdk8splus20/v2 v2.0.0-beta.11
cdk8s+ is a software development framework that provides high level abstractions for authoring Ku...12 versions - Latest release: almost 2 years ago - 5 stars on GitHub
github.com/cdk8s-team/cdk8s-plus-go/cdk8splus21/v2 v2.0.0-beta.12
cdk8s+ is a software development framework that provides high level abstractions for authoring Ku...13 versions - Latest release: almost 2 years ago - 1 dependent package - 1 dependent repositories - 4 stars on GitHub
github.com/kichik/projen-deploy-key-test-go/projendeploykeytest v0.0.4
Test repo for https://github.com/projen/projen/pull/19061 version - Latest release: almost 2 years ago - 0 stars on GitHub
github.com/hsiehshujeng/cdk-emrserverless-with-delta-lake/cdkemrserverlesswithdeltalake v0.0.0
This construct builds some elements for you to quickly launch an EMR Serverless application. Afte...1 version - Latest release: almost 2 years ago - 8 stars on GitHub
github.com/hsiehshujeng/cdk-emrserverless-with-delta-lake/cdkemrserverlesswithdeltalake/v2 v2.0.14
This construct builds some elements for you to quickly launch an EMR Serverless application. Afte...6 versions - Latest release: almost 2 years ago - 8 stars on GitHub
github.com/HsiehShuJeng/cdk-databrew-cicd-go/cdkdatabrewcicd v0.1.39
A construct for AWS Glue DataBrew wtih CICD1 version - Latest release: almost 2 years ago - 0 stars on GitHub
github.com/hsiehshujeng/cdk-databrew-cicd-go/cdkdatabrewcicd v0.1.39
1 version - Latest release: almost 2 years ago - 0 stars on GitHubgithub.com/mbonig/state-machine/matthewbonigstatemachine v0.0.16 💰
A Step Function state machine construct focused on working well with the Workflow Studio7 versions - Latest release: almost 2 years ago - 24 stars on GitHub
github.com/opencdk8s/cdk8s-kuma-types-go/opencdk8scdk8skumatypes v0.0.12
@opencdk8s/cdk8s-kuma-types7 versions - Latest release: almost 2 years ago - 0 stars on GitHub
github.com/opencdk8s/cdk8s-argo-rollouts-go/opencdk8scdk8sargorollout v0.0.14
@opencdk8s/cdk8s-argo-rollout10 versions - Latest release: almost 2 years ago - 0 stars on GitHub
github.com/opencdk8s/cdk8s-aws-lb-controller-api-object-go/opencdk8scdk8sawslbcontrollerapiobject v0.0.7
@opencdk8s/cdk8s-aws-lb-controller-api-object8 versions - Latest release: almost 2 years ago - 0 stars on GitHub
github.com/opencdk8s/cdk8s-redis-cluster-go/cdk8srediscluster v0.1.7
Replicated, password protected redis cluster setup.9 versions - Latest release: almost 2 years ago - 0 stars on GitHub